| Catalog# |
CH57 |
| Source |
E.coli |
| Description |
Recombinant Human 35-alpha calcimedin is produced with our E. coli expression system. The target protein is expressed with sequence (Met1-Asp323) of Human ANXA3. |
| Names |
35-alpha calcimedin,Annexin III,Annexin-3,Inositol 1,2-cyclic phosphate 2-phosphohydrolase,Lipocortin III,Placental anticoagulant protein III,PAP-III,ANX3 |
| Accession # |
P12429 |
| Formulation |
Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4. |
| Shipping |
The product is shipped at ambient temperature. |
| Reconstitution |
Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg/ml.
Dissolve the lyophilized protein in 1X PBS.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
| Storage |
Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
| Purity |
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
| Endotoxin |
Less than 0.1 ng/µg (1 IEU/µg). |
| Amino Acid Sequence |
MASIWVGHRGTVRDYPDFSPSVDAEAIQKAIRGIGTDEKMLISILTERSNAQRQLIVKEYQAAYG KELKDDLKGDLSGHFEHLMVALVTPPAVFDAKQLKKSMKGAGTNEDALIEILTTRTSRQMKDISQ AYYTVYKKSLGDDISSETSGDFRKALLTLADGRRDESLKVDEHLAKQDAQILYKAGENRWGTDED KFTEILCLRSFPQLKLTFDEYRNISQKDIVDSIKGELSGHFEDLLLAIVNCVRNTPAFLAERLHR ALKGIGTDEFTLNRIMVSRSEIDLLDIRTEFKKHYGYSLYSAIKSDTSGDYEITLLKICGGDD*
|
| Background |
Annexin A3（ANXA3）contains 4 annexin repeats and belongs to the annexin family. Members of this calcium-dependent phospholipid-binding protein family play a role in the regulation of cellular growth and in signal transduction pathways. It is abnormally expressed in fetuses of both IVF and ICSI, which may contribute to the increase risk of birth defects in these ART. ANXA3 is Inhibitor of phospholipase A2 and cleaves the cyclic bond of inositol 1,2-cyclic phosphate to form inositol 1-phosphate. it also also play a role in anti-coagulant properties. |
