| Catalog# |
CJ14 |
| Source |
Human cells |
| Description |
Recombinant mouse CNDP2 is produced with our mammalian expression system in human cells. The target protein is expressed with sequence (Met1-Asn475) of mouse CNDP2 fused with a polyhistidine tag at the C-terminus. |
| Names |
CNDP2/CNDP dipeptidase 2/Cytosolic non-specific dipeptidase/Glutamate carboxypeptidase-like protein 1/Cn2 |
| Accession # |
Q9D1A2 |
| Formulation |
Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.4 |
| Shipping |
The product is shipped at ambient temperature. |
| Reconstitution |
Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg/ml.
Dissolve the lyophilized protein in 3X PBS.
Please aliquot the reconstituted solution |
| Storage |
Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20°C for 5 months. |
| Purity |
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
| Endotoxin |
Less than 0.1 ng/µg (1 IEU/µg). |
| Amino Acid Sequence |
MSALKAVFQYIDENQDRYVKKLAEWVAIQSVSAWPEKRGEIRRMMEVAAADVQRLGGSVELVDIG KQKLPDGSEIPLPPILLGKLGSDPQKKTVCIYGHLDVQPAALEDGWDSEPFTLVEREGKLYGRGS TDDKGPVAGWMNALEAYQKTGQEIPVNLRFCLEGMEESGSEGLDELIFAQKDKFFKDVDYVCISD NYWLGKNKPCITYGLRGICYFFIEVECSDKDLHSGVYGGSVHEAMTDLISLMGCLVDKKGKILIP GINDAVAPVTDEEHALYDHIDFDMEEFAKDVGAETLLHSCKKDILMHRWRYPSLSLHGIEGAFSG SGAKTVIPRKVVGKFSIRLVPDMIPEVVSEQVSSYLSKKFAELQSPNKFKVYMGHGGKPWVSDFN HPHYQAGRRALKTVFGVEPDLTREGGSIPVTLTFQEATGKNVMLLPVGSADDGAHSQNEKLNRLN YIEGTKMLAAYLYEVSQLKNVDHHHHHH*
|
| Background |
Mouse cytosolic non-specific dipeptidase(CNDP2) is a cytoplasm protein which belongs to the peptidase M20A family. CNDP2 has 2 Isoform: Isoform 1 is ubiquitously expressed with higher levels in kidney and liver (at protein level). Isoform 2 is expressed in fetal tissues, it is only expressed in adult liver and placental tissues. CNDP2 hydrolyzes a variety of dipeptides including L-carnosine and has a strong preference for Cys-Gly. It is a cytosolic enzyme that can hydrolyze carnosine to yield l-histidine and beta-alanine. CNDP2 is highly expressed in the histaminergic neurons in the tuberomammillary nucleus, implying that it may supply histidine to histaminergic neurons for histamine synthesis. It may play a role as tumor suppressor in hepatocellular carcinoma (HCC) cells. |
