| Catalog# |
CH68 |
| Source |
E.coli |
| Description |
Recombinant Mouse Protein S100-A8 is produced with our E. coli expression system. The target protein is expressed with sequence (Met1-Glu89) of Mouse Mrp8 fused with a 6His tag at the C-terminus. |
| Names |
Protein S100-A8,Calgranulin-A,Chemotactic cytokine CP-10,Leukocyte L1 complex light chain,Migration inhibitory factor-related protein 8,MRP-8,Pro-inflammatory S100 cytokine,S100 calcium-binding protein A8,S100a8,Caga, Mrp8 |
| Accession # |
P27005 |
| Formulation |
Lyophilized from a 0.2 μm filtered solution of 20mMTris, pH8.0 |
| Shipping |
The product is shipped at ambient temperature. |
| Reconstitution |
Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg/ml.
Dissolve the lyophilized protein in 1X PBS.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
| Storage |
Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
| Purity |
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
| Endotoxin |
Less than 0.1 ng/µg (1 IEU/µg). |
| Amino Acid Sequence |
MATELEKALSNVIEVYHNYSGIKGNHHALYRDDFRKMVTTECPQFVQNKNTESLFKELDVNSDNA INFEEFLVLVIRVGVAAHKDSHKELEHHHHHH*
|
| Background |
Protein S100-A8(Mrp8) contains 2 EF-hand domains and belongs to the S-100 family. Mrp8 binds two calcium ions per molecule with an affinity similar to that of the S-100 proteins. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. It may function in the inhibition of casein kinase and as a cytokine. Altered expression of this protein is associated with the disease cystic fibrosis. |