| Catalog# |
C684 |
| Source |
HEK293 |
| Description |
Recombinant Human α-Amylase 1/AMY1A is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Gln49-Ser356) of Human AMY1A fused with a polyhistidine tag at the C-terminus. |
| Names |
Alpha-Amylase 1, 1,4-Alpha-D-Glucan Glucanohydrolase 1,Salivary Alpha-Amylase, AMY1A, AMY1, AMY1B, AMY1C |
| Accession # |
P04745 |
| Shipping |
The product is shipped at ambient temperature. |
| Storage |
Store at < -20°C, stable for 6 months after receipt.
Please minimize freeze-thaw cycles. |
| Purity |
Greater than 95% as determined by reducing SDS-PAGE. |
| Endotoxin |
Less than 0.1 ng/μg (1 IEU/μg). |
| Amino Acid Sequence |
QYSSNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIHNPFRPWWERYQPV SYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVP YSGWDFNDGKCKTGSGDIENYNDATQVRDCRLSGLLDLALGKDYVRSKIAEYMNHLIDIGVAGFR IDASKHMWPGDIKAILDKLHNLNSNWFPEGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGA KLGTVIRKWNGEKMSYLKNWGEGWGFMPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAV GFMLAHPYGFTRVMSSYRWPRYFENGKDVNDWVGPPNDNGVTKEVTINPDTTCGNDWVCEHRWRQ IRNMVNFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWTFSLTLQTGLPAGTYCDVISG DKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKLVDHHHHHH
|
| Background |
α-Amylase 1 (AMY1A) is a member of the Glycosyl Hydrolase 13 family. The human genome has a cluster of several amylase genes that are expressed at high levels in either salivary gland or pancreas. α-Amylase 1 is the isoenzyme produced by the salivary gland. α-Amylase 1 is involved in the carbohydrate metabolic process; it hydrolyzes 1,4-α-glucoside bonds in oligosaccharides andpolysaccharides, and thus catalyzes the first step in the digestion of dietary starch and glycogen. α-Amylase 1 has metal ion binding activity, one subunit can bind one calcium ion and one chloride ion. |
