| Catalog# |
C947 |
| Source |
Human Cells |
| Description |
Recombinant Human Ameloblastin/AMBN is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Val27-Pro447) of Human AMBN fused with a polyhistidine tag at the C-terminus. |
| Names |
Ameloblastin, AMBN |
| Accession # |
Q9NP70 |
| Formulation |
Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.4 |
| Shipping |
The product is shipped at ambient temperature. |
| Reconstitution |
Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg/ml.
Dissolve the lyophilized protein in 5X PBS.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
| Storage |
Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20°C for 7 months. |
| Purity |
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
| Endotoxin |
Less than 0.1 ng/µg (1 IEU/µg). |
| Amino Acid Sequence |
VPFFPQQSGTPGMASLSLETMRQLGSLQRLNTLSQYSRYGFGKSFNSLWMHGLLPPHSSLPWMRP REHETQQYEYSLPVHPPPLPSQPSLKPQQPGLKPFLQSAAATTNQATALKEALQPPIHLGHLPLQ EGELPLVQQQVAPSDKPPKPELPGVDFADPQGPSLPGMDFPDPQGPSLPGLDFADPQGSTIFQIA RLISHGPMPQNKQSPLYPGMLYVPFGANQLNAPARLGIMSSEEVAGGREDPMAYGAMFPGFGGMR PGFEGMPHNPAMGGDFTLEFDSPVAATKGPENEEGGAQGSPMPEANPDNLENPAFLTELEPAPHA GLPALPKDDIPGLPRSPSGKMKGLPSVTPAAADPLMTPELADVYRTYDADMTTSVDFQEEATMDT TMAPNSLQTSMPGNKAQEPEMMHDAWHFQEPVDHHHHHH
|
| Background |
Ameloblastin (AMBN) is a member of the Ameloblastin family. AMBN is a secreted protein and is specially expressed in ameloblast, localizing to the Tomes processes of secretory ameloblasts and in the sheath space between rod-interrod enamel Mutations of this protein may be associated with dentinogenesis imperfect and autosomal dominant amylogenesis imperfect. Ameloblastin may play an important role in the formation and mineralization of the enamel matrix. Biochemically, it is classified as an intrinsically disordered protein (IDP). Its biological role remains largely unknown. |
