| Catalog# |
CI36 |
| Source |
HEK293 |
| Description |
Recombinant Human Alpha-amylase 2B/1,4-alpha-D-glucan glucanohydrolase 2B/Carcinoid alpha-amylase is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Gln16-Leu511) of Human AMY2B fused with a 6His tag at the C-terminus. |
| Names |
Alpha-amylase 2B, 1,4-alpha-D-glucan glucanohydrolase 2B, Carcinoid alpha-amylase, HXA, AMY2, AMY3 |
| Accession # |
P19961 |
| Formulation |
Supplied as a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.4 |
| Shipping |
The product is shipped on dry ice/ice packs. |
| Storage |
Store at < -20°C, stable for 6 months after receipt.
Please minimize freeze-thaw cycles. |
| Purity |
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
| Endotoxin |
Less than 0.1 ng/µg (1 IEU/µg). |
| Amino Acid Sequence |
QYSPNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIHNPFRPWWERYQPV SYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMSGNAVSAGTSSTCGSYFNPGSRDFPAVP YSGWDFNDGKCKTGSGDIENYNDATQVRDCRLVGLLDLALEKDYVRSKIAEYMNHLIDIGVAGFR LDASKHMWPGDIKAILDKLHNLNSNWFPAGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGA KLGTVIRKWNGEKMSYLKNWGEGWGFMPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAV GFMLAHPYGFTRVMSSYRWPRQFQNGNDVNDWVGPPNNNGVIKEVTINPDTTCGNDWVCEHRWRQ IRNMVNFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWTFSLTLQTGLPAGTYCDVISG DKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKLVDHHHHHH*
|
| Background |
Alpha-amylase 2B is an enzyme that in humans is encoded by the AMY2B gene. Alpha-amylase 2B is a secreted protein and belongs to the glycosyl hydrolase 13 family. It hydrolyzes 1,4-alpha-glucoside bonds in oligosaccharides and polysaccharides, and thus catalyze the first step in digestion of dietary starch and glycogen. The human genome has a cluster of several amylase genes that are expressed at high levels in either salivary gland or pancreas. This gene encodes an amylase isoenzyme produced by the pancreas. Diseases associated with AMY2B include pancreatitis, and thyroiditis, and among its related super-pathways are Metabolic pathways and MPS IIIC - Sanfilippo syndrome C. |
