| Catalog# |
C205 |
| Source |
E.coli |
| Description |
Recombinant Human Annexin A2/ANXA2 is produced by our E. coli expression system. The target protein is expressed with sequence (Ser2-Asp339) of Human ANXA2. |
| Names |
Annexin A2, Annexin II, Annexin-2, Calpactin I Heavy Chain, Calpactin-1 Heavy Chain, Chromobindin-8, Lipocortin II, Placental Anticoagulant Protein IV, PAP-IV, Protein I, p36, ANXA2, ANX2, ANX2L4, CAL1H, LPC2D |
| Accession # |
P07355 |
| Formulation |
Lyophilized from a 0.2 μm filtered solution of 20mM Tris-HCl, 150mM NaCl, 1mM EDTA, pH 7.5 |
| Shipping |
The product is shipped at ambient temperature. |
| Reconstitution |
Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg/ml.
Dissolve the lyophilized protein in 1X PBS.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
| Storage |
Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
| Purity |
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
| Endotoxin |
Less than 0.1 ng/μg (1 IEU/μg). |
| Amino Acid Sequence |
MSTVHEILCKLSLEGDHSTPPSAYGSVKAYTNFDAERDALNIETAIKTKGVDEVTIVNILTNRSN AQRQDIAFAYQRRTKKELASALKSALSGHLETVILGLLKTPAQYDASELKASMKGLGTDEDSLIE IICSRTNQELQEINRVYKEMYKTDLEKDIISDTSGDFRKLMVALAKGRRAEDGSVIDYELIDQDA RDLYDAGVKRKGTDVPKWISIMTERSVPHLQKVFDRYKSYSPYDMLESIRKEVKGDLENAFLNLV QCIQNKPLYFADRLYDSMKGKGTRDKVLIRIMVSRSEVDMLKIRSEFKRKYGKSLYYYIQQDTKG DYQKALLYLCGGDD
|
| Background |
Annexin A2 (ANXA2) is a member of the annexin family and has roles in the regulation of cellular growth and in signal transduction pathways. ANXA2 protein is associated with sickle cell osteonecrosis and the expression reduce of ANXA2 is associated with osteosarcoma metastases. ANXA2 functions as an autocrine factor, it can increases osteoclast formation and bone resorption. ANXA2 is involved in muscular dystrophies. In humans, the up-regulation of ANXA2 is related with colon adenocarcinoma cell differentiation. |
| References |
Iheagwara UK,et al.Influenza virus infection elicits protective antibodies and T cells specific for host cell antigens also expressed as tumor associated antigens: a new view of cancer immunosurveillance
PMID:24778322
http://www.ncbi.nlm.nih.gov/pubmed/24778322 |
