| Catalog# |
C432 |
| Source |
HEK293 |
| Description |
Recombinant Human Apolipoprotein H/ApoH is produced with our mammalian expression system in human cells. The target protein is expressed with sequence (G20-S345) of Human APOH fused with a polyhistidine tag at the C-terminus. |
| Names |
Beta-2-Glycoprotein 1, APC inhibitor, Activated Protein C-Binding Protein, Anticardiolipin Cofactor, Apolipoprotein H, Apo-H, Beta-2-Glycoprotein I, B2GPIBeta(2)GPI, APOH, B2G1 |
| Accession # |
P02749 |
| Formulation |
Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2 |
| Shipping |
The product is shipped at ambient temperature. |
| Reconstitution |
Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg/ml.
Dissolve the lyophilized protein in 1X PBS.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
| Storage |
Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
| Purity |
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
| Endotoxin |
Less than 0.1 ng/μg (1 IEU/μg). |
| Amino Acid Sequence |
GRTCPKPDDLPFSTVVPLKTFYEPGEEITYSCKPGYVSRGGMRKFICPLTGLWPINTLKCTPRVC PFAGILENGAVRYTTFEYPNTISFSCNTGFYLNGADSAKCTEEGKWSPELPVCAPIICPPPSIPT FATLRVYKPSAGNNSLYRDTAVFECLPQHAMFGNDTITCTTHGNWTKLPECREVKCPFPSRPDNG FVNYPAKPTLYYKDKATFGCHDGYSLDGPEEIECTKLGNWSAMPSCKASCKVPVKKATVVYQGER VKIQEKFKNGMLHGDKVSFFCKNKEKKCSYTEDAQCIDGTIEVPKCFKEHSSLAFWKTDASDVKP CVDHHHHHH
|
| Background |
Apolipoprotein H (ApoH) is a 50 kDa variably glycosylated member of the complement control superfamily of proteins. Human ApoH is a major phospholipid binding protein and an important component to measure in the assessment of anti-phospholipid syndrome. Hepatocyte-derived ApoH binds to negatively charged phospholipids . It circulates as a component of lipoprotein particles and as a lipid-free serum protein. Human ApoH is also more specific than anti-cardiolipin antibodies and its presence correlates better with thrombotic risk. Mature human ApoH shares 76% and 82% aa sequence identity with mouse and rat ApoH. |
