| Catalog# |
C557 |
| Source |
HEK293 |
| Description |
Recombinant Human Apolipoprotein M/ApoM is produced with our mammalian expression system in human cells. The target protein is expressed with sequence (Met1-Asn188) of Human APOM fused with a polyhistidine tag at the C-terminus. |
| Names |
Apolipoprotein M, Apo-M, ApoM, Protein G3a, APOM, G3A, NG20 |
| Accession # |
O95445 |
| Formulation |
Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2 |
| Shipping |
The product is shipped at ambient temperature. |
| Reconstitution |
Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg/ml.
Dissolve the lyophilized protein in 1X PBS.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
| Storage |
Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
| Purity |
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
| Endotoxin |
Less than 0.1 ng/μg (1 IEU/μg). |
| Amino Acid Sequence |
MFHQIWAALLYFYGIILNSIYQCPEHSQLTTLGVDGKEFPEVHLGQWYFIAGAAPTKEELATFDP VDNIVFNMAAGSAPMQLHLRATIRMKDGLCVPRKWIYHLTEGSTDLRTEGRPDMKTELFSSSCPG GIMLNETGQGYQRFLLYNRSPHPPEKCVEEFKSLTSCLDSKAFLLTPRNQEACELSNNVDHHHHH H
|
| Background |
Apolipoprotein M is a secreted protein which belongs to the Lipocalin family. ApoM often presents in high density lipoprotein (HDL) and to a lesser extent in triglyceride-rich lipoproteins (TGRLP) and low density lipoproteins (LDL). The ApoM gene encoded protein is expressed in liver and kidney, secreted through the plasma membrane but remains membrane-bound. ApoM probably involved in lipid transport. ApoM can bind sphingosine-1-phosphate, myristic acid, palmitic acid and stearic acid, retinol, all-trans-retinoic acid and 9-cis-retinoic acid. The expression of ApoM could be regulated by platelet activating factor (PAF), Transforming Growth Factors (TGF), Insulin-Like Growth factor (IGF) and Leptin. |
