| Catalog# |
C097 |
| Source |
E.coli |
| Description |
Recombinant Human Acyl-Protein Thioesterase 1/APT-1 is produced with our E. coli expression system. The target protein is expressed with sequence (Met1-Asp230) of Human APT-1 fused with a His tag at the N-terminus. |
| Names |
Acyl-Protein Thioesterase 1, APT-1, hAPT1, Lysophospholipase 1, Lysophospholipase I, LPL-I, LysoPLA I, LYPLA1, APT1, LPL1 |
| Accession # |
O75608 |
| Formulation |
Supplied as a 0.2 μm filtered solution of 20mM Tris-HCl, 100mM NaCl, 1mM DTT, 10% Glycerol, pH 8.0 |
| Shipping |
The product is shipped on dry ice/ice packs. |
| Storage |
Store at < -20°C, stable for 6 months after receipt.
Please minimize freeze-thaw cycles. |
| Purity |
Greater than 95% as determined by reducing SDS-PAGE. |
| Endotoxin |
Less than 0.1 ng/μg (1 IEU/μg). |
| Amino Acid Sequence |
MGSSHHHHHHSSGLVPRGSHMCGNNMSTPLPAIVPAARKATAAVIFLHGLGDTGHGWAEAFAGIR SSHIKYICPHAPVRPVTLNMNVAMPSWFDIIGLSPDSQEDESGIKQAAENIKALIDQEVKNGIPS NRIILGGFSQGGALSLYTALTTQQKLAGVTALSCWLPLRASFPQGPIGGANRDISILQCHGDCDP LVPLMFGSLTVEKLKTLVNPANVTFKTYEGMMHSSCQQEMMDVKQFIDKLLPPID
|
| Background |
Acyl-Protein Thioesterase 1 (APT-1) is lysophospholipase that belongs to the AB hydrolase 2 family. APT-1 performs on biological membranes to regulate the multifunctional lysophospholipids. It hydrolyzes fatty acids from S-acylated cysteine residues in proteins such as trimeric G alpha proteins or HRAS; in addition, it also has depalmitoylating activity and low lysophospholipase activity. |
| References |
Koyama K,et al.Identification of Bioactivating Enzymes Involved in the Hydrolysis of Laninamivir Octanoate, a Long-Acting Neuraminidase Inhibitor, in Human Pulmonary Tissue
PMID:24682756
http://www.ncbi.nlm.nih.gov/pubmed/24682756 |
