| Catalog# |
C153 |
| Source |
E.coli |
| Description |
Recombinant Human Nucleolar Protein 3/NOL3 (HIS-tagged) is produced with our E. coli expression system. The target protein is expressed with sequence (Met1-Ser208) of Human NOL3. |
| Names |
Nucleolar Protein 3, Apoptosis Repressor With CARD, Muscle-Enriched Cytoplasmic Protein, Myp, Nucleolar Protein of 30 kDa, Nop30 |
| Accession # |
O60936 |
| Formulation |
Supplied as a 0.2 μm filtered solution of 25mM Tris-HCl, 1mM DTT, 1mM EDTA, 2mM β-ME, 20% Glycerol, pH 7.5 |
| Shipping |
The product is shipped on dry ice/ice packs. |
| Storage |
Store at < -20°C, stable for 6 months after receipt.
Please minimize freeze-thaw cycles. |
| Purity |
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
| Endotoxin |
Less than 0.1 ng/μg (1 IEU/μg). |
| Amino Acid Sequence |
MGNAQERPSETIDRERKRLVETLQADSGLLLDALLARGVLTGPEYEALDALPDAERRVRRLLLLV QGKGEAACQELLRCAQRTAGAPDPAWDWQHVGPGYRDRSYDPPCPGHWTPEAPGSGTTCPGLPRA SDPDEAGGPEGSEAVQSGTPEEPEPELEAEASKEAEPEPEPEPELEPEAEAEPEPELEPEPDPEP EPDFEERDESEDS
|
| Background |
Nucleolar protein 3 is encoded by NOL3 gene. Multiple transcript variants encoding different isoforms have been found for this gene. So far, Nucleolar protein 3 has show to have two Isoforms. Isoform 1 may be involved in RNA splicing.Isoform 2 may inhibit apoptosis.It has been shown to down-regulate the enzyme activities of caspase 2, caspase 8 and tumor protein p53. |