| Catalog# |
CE71 |
| Source |
E.coli |
| Description |
Recombinant Human Kidney-Type Arginase/ARG2 is produced by our E. coli expression system. The target protein is expressed with sequence (Met1-Ile354) of Human ARG2 fused with a 6His tag at the N-terminus. |
| Names |
Arginase-2 Mitochondrial, Kidney-Type Arginase, Non-Hepatic Arginase, Type II Arginase, ARG2 |
| Accession # |
P78540 |
| Formulation |
Supplied as a 0.2 μm filtered solution of 20mM TrisHCl, 10% Glycerol, pH 8.0 |
| Shipping |
The product is shipped on dry ice/ice packs. |
| Storage |
Store at < -20°C, stable for 6 months after receipt.
Please minimize freeze-thaw cycles. |
| Biological Activity |
IN STOCK |
| Purity |
Greater than 95% as determined by reducing SDS-PAGE. |
| Endotoxin |
Less than 0.1 ng/µg (1 IEU/µg). |
| Amino Acid Sequence |
MGSSHHHHHHSSGLVPRGSHMSLRGSLSRLLQTRVHSILKKSVHSVAVIGAPFSQGQKRKGVEHG PAAIREAGLMKRLSSLGCHLKDFGDLSFTPVPKDDLYNNLIVNPRSVGLANQELAEVVSRAVSDG YSCVTLGGDHSLAIGTISGHARHCPDLCVVWVDAHADINTPLTTSSGNLHGQPVSFLLRELQDKV PQLPGFSWIKPCISSASIVYIGLRDVDPPEHFILKNYDIQYFSMRDIDRLGIQKVMERTFDLLIG KRQRPIHLSFDIDAFDPTLAPATGTPVVGGLTYREGMYIAEEIHNTGLLSALDLVEVNPQLATSE EEAKTTANLAVDVIASSFGQTREGGHIVYDQLPTPSSPDESENQARVRI
|
| Background |
Kidney-Type Arginase (ARG2) is a member of the arginase family. Arginase is a manganese-containing enzyme which catalyzes the hydrolysis of arginine to ornithine and urea. ARG2 is highly expressed in kidney and prostate, not founded in the liver, heart and pancreas. ARG2 has been implicated in the regulation of the arginine/ornithine concentrations in the cell. ARG2 may take part in the regulation of extra-urea cycle arginine metabolism and in down-regulation of nitric oxide synthesis. The extrahepatic arginase functions to regulate L-arginine bioavailability to NO synthase. |
