| Catalog# |
C301 |
| Source |
HEK293 |
| Description |
Recombinant Human Arylsulfatase A/ARSA is produced with our mammalian expression system in human cells. The target protein is expressed with sequence (Arg19-507Ala) of Human ARSA fused with a polyhistidine tag at the C-terminus |
| Names |
Arylsulfatase A, ASA, Cerebroside-Sulfatase, ARSA |
| Accession # |
P15289 |
| Formulation |
Supplied as a 0.2 μm filtered solution of 20mM Tris-HCl, 150mM NaCl, pH 7.5 |
| Shipping |
The product is shipped on dry ice/ice packs. |
| Storage |
Store at < -20°C, stable for 6 months after receipt.
Please minimize freeze-thaw cycles. |
| Purity |
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
| Endotoxin |
Less than 0.1 ng/μg (1 IEU/μg). |
| Amino Acid Sequence |
RPPNIVLIFADDLGYGDLGCYGHPSSTTPNLDQLAAGGLRFTDFYVPVSLCTPSRAALLTGRLPV RMGMYPGVLVPSSRGGLPLEEVTVAEVLAARGYLTGMAGKWHLGVGPEGAFLPPHQGFHRFLGIP YSHDQGPCQNLTCFPPATPCDGGCDQGLVPIPLLANLSVEAQPPWLPGLEARYMAFAHDLMADAQ RQDRPFFLYYASHHTHYPQFSGQSFAERSGRGPFGDSLMELDAAVGTLMTAIGDLGLLEETLVIF TADNGPETMRMSRGGCSGLLRCGKGTTYEGGVREPALAFWPGHIAPGVTHELASSLDLLPTLAAL AGAPLPNVTLDGFDLSPLLLGTGKSPRQSLFFYPSYPDEVRGVFAVRSGKYKAHFFTQGSAHSDT TADPACHASSSLTAHEPPLLYDLSKDPGENYNLLGGVAGATPEVLQALKQLQLLKAQLDAAVTFG PSQVARGEDPALQICCHPGCTPRPACCHCPDPHAVDHHHHHH
|
| Background |
Arylsulfatase A (ARSA) is a lysosomal enzyme that breaks down Cerebroside 3-Sulfate, a major constituent of the myelin sheet, into Cerebroside and Sulfate. The ARSA deficiency results in Metachromatic Leukodystrophy (MLD), a lysosomal storage disease in the central and peripheral nervous systems with severe and progressive neurological symptoms. Recombinant Human ARSA corresponds to the ARSA mature peptide and has sulfatase activity. |
