| Catalog# |
CF50 |
| Source |
E.coli |
| Description |
Recombinant Human Cysteine Protease ATG4A/ATG4A is produced with our E. coli expression system. The target protein is expressed with sequence (Met1-Val398) of Human ATG4A fused with a 6His tag at the N-terminus. |
| Names |
Cysteine Protease ATG4A, AUT-Like 2 Cysteine Endopeptidase, Autophagin-2, Autophagy-Related Cysteine Endopeptidase 2, Autophagy-Related Protein 4 Homolog A, hAPG4A, ATG4A, APG4A, AUTL2 |
| Accession # |
Q8WYN0 |
| Formulation |
Supplied as a 0.2 μm filtered solution of PBS, pH 7.4 |
| Shipping |
The product is shipped on dry ice/ice packs. |
| Storage |
Store at < -20°C, stable for 6 months after receipt.
Please minimize freeze-thaw cycles. |
| Purity |
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
| Endotoxin |
Less than 0.1 ng/µg (1 IEU/µg). |
| Amino Acid Sequence |
MGSSHHHHHHSSGLVPRGSHMESVLSKYEDQITIFTDYLEEYPDTDELVWILGKQHLLKTEKSKL LSDISARLWFTYRRKFSPIGGTGPSSDAGWGCMLRCGQMMLAQALICRHLGRDWSWEKQKEQPKE YQRILQCFLDRKDCCYSIHQMAQMGVGEGKSIGEWFGPNTVAQVLKKLALFDEWNSLAVYVSMDN TVVIEDIKKMCRVLPLSADTAGDRPPDSLTASNQSKGTSAYCSAWKPLLLIVPLRLGINQINPVY VDAFKECFKMPQSLGALGGKPNNAYYFIGFLGDELIFLDPHTTQTFVDTEENGTVNDQTFHCLQS PQRMNILNLDPSVALGFFCKEEKDFDNWCSLVQKEILKENLRMFELVQKHPSHWPPFVPPAKPEV TTTGAEFIDSTEQLEEFDLEEDFEILSV
|
| Background |
Cysteine Protease ATG4A (ATG4A) is a cytoplasmic protein that belongs to the peptidase C54 family. ATG4A is widely expressed in many tissues at a low level, but the highest expression is observed in skeletal muscle and brain. ATG4A is a cysteine protease required for autophagy; it cleaves the C-terminal part of MAP1LC3, GABARAPL2 or GABARAP. ATG4A is inhibited by N-ethylmaleimide. It is suggested that ATG4A has a significant role in suppressing various cancers. |
