| Catalog# |
C559 |
| Source |
HEK293 |
| Description |
Recombinant Human BMP and Activin Membrane-Bound Inhibitor Homolog/BAMBI is produced with our mammalian expression system in human cells. The target protein is expressed with sequence (Val21-Ala152) of Human BAMBI fused with a polyhistidine tag at the C-terminus. |
| Names |
BMP and Activin Membrane-Bound Inhibitor Homolog, Non-Metastatic Gene A Protein, Putative Transmembrane Protein NMA, BAMBI, NMA |
| Accession # |
Q13145 |
| Formulation |
Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.4 |
| Shipping |
The product is shipped at ambient temperature. |
| Reconstitution |
Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg/ml.
Dissolve the lyophilized protein in 1X PBS.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
| Storage |
Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
| Purity |
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
| Endotoxin |
Less than 0.1 ng/μg (1 IEU/μg). |
| Amino Acid Sequence |
VLLTKGEIRCYCDAAHCVATGYMCKSELSACFSRLLDPQNSNSPLTHGCLDSLASTTDICQAKQA RNHSGTTIPTLECCHEDMCNYRGLHDVLSPPRGEASGQGNRYQHDGSRNLITKVQELTSSKELWF RAVDHHHHHH
|
| Background |
BMP and Activin Membrane-Bound Inhibitor Homolog (BAMBI) is a single-pass type I membrane protein that belongs to the BAMBI family. BAMBI is highly expression in kidney medulla, placenta and spleen. BAMBI is induced by BMP signaling through the evolutionary conserved BMP-responsive elements in its promoter. BAMBI plays important roles in signal transduction in many developmental and pathological processes. BAMBI transcription is activated by Wnt/beta-catenin signaling then its expression is aberrantly elevated in most colorectal carcinomas. BAMBI stably associates with TGF-β-family receptors and inhibits BMP and activin as well as TGF-β signalling. BAMBI negatively regulates TGF-β-family signalling by a regulatory mechanism involving the interaction of signalling receptors with a pseudoreceptor. |
