| Catalog# |
CE05 |
| Source |
E.coli |
| Description |
Recombinant Human 3-Hydroxybutyrate Dehydrogenase Type 2 is produced by our E. coli expression system. The target protein is expressed with sequence (Met1-Leu245) of Human BDH2 fused with a 6His tag at the N-terminus. |
| Names |
3-Hydroxybutyrate Dehydrogenase Type 2, Dehydrogenase/Reductase SDR Family Member 6, Oxidoreductase UCPA, R-Beta-Hydroxybutyrate Dehydrogenase, BDH2, DHRS6 |
| Accession # |
Q9BUT1 |
| Formulation |
Supplied as a 0.2 μm filtered solution of 20mM Tris-HCl, 100mM NaCl, pH 8.0 |
| Shipping |
The product is shipped on dry ice/ice packs. |
| Storage |
Store at < -20°C, stable for 6 months after receipt.
Please minimize freeze-thaw cycles. |
| Purity |
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
| Endotoxin |
Less than 0.1 ng/μg (1 IEU/μg). |
| Amino Acid Sequence |
MGSSHHHHHHSSGLVPRGSHMGRLDGKVIILTAAAQGIGQAAALAFAREGAKVIATDINESKLQE LEKYPGIQTRVLDVTKKKQIDQFASEVERLDVLFNVAGFVHHGTVLDCEEKDWDFSMNLNVRSMY LMIKAFLPKMLAQKSGNIINMSSVASSVKGVVNRCVYSTTKAAVIGLTKSVAADFIQQGIRCNCV CPGTVDTPSLQERIQARGNPEEARNDFLKRQKTGRFATAEEIAMLCVYLASDESAYVTGNPVIID GGWSL
|
| Background |
3-Hydroxybutyrate Dehydrogenase Type 2 belongs to the short-chain dehydrogenases/reductases (SDR) family. 3-Hydroxybutyrate Dehydrogenase Type 2 may play an important role in the peripheral utilization of 3-hydroxybutyrate. The cytoplasmic localization with its high ratio of oxidized NAD+, the NAD+ dependence and the kinetic parameters of 3-Hydroxybutyrate Dehydrogenase Type 2 make it suitable to conbert high levels of circulating 3-hydroxybutyrate into acetoacetate. |
