| Catalog# |
CA37 |
| Source |
Human Cells |
| Description |
Recombinant Human Lysosomal Pro-X Carboxypeptidase/PRCP is produced by our our mammalian expression system in human cells. The target protein is expressed with sequence (Leu22-His496) of Human PRCP fused with a His tag at the C-terminus. |
| Names |
Lysosomal Pro-X Carboxypeptidase, Angiotensinase C, Lysosomal Carboxypeptidase C, Proline Carboxypeptidase, Prolylcarboxypeptidase, PRCP, PRCP, PCP |
| Accession # |
P42785 |
| Formulation |
Supplied as a 0.2 μm filtered solution of 20mM NaAc-HAc,150mM NaCl,10%Glycerol,pH4.5 |
| Shipping |
The product is shipped on dry ice/ice packs. |
| Storage |
Store at < -20°C, stable for 7 months after receipt.
Please minimize freeze-thaw cycles. |
| Purity |
Greater than 95% as determined by reducing SDS-PAGE. |
| Endotoxin |
Less than 0.1 ng/µg (1 IEU/µg). |
| Amino Acid Sequence |
LRPALRALGSLHLPTNPTSLPAVAKNYSVLYFQQKVDHFGFNTVKTFNQRYLVADKYWKKNGGSI LFYTGNEGDIIWFCNNTGFMWDVAEELKAMLVFAEHRYYGESLPFGDNSFKDSRHLNFLTSEQAL ADFAELIKHLKRTIPGAENQPVIAIGGSYGGMLAAWFRMKYPHMVVGALAASAPIWQFEDLVPCG VFMKIVTTDFRKSGPHCSESIHRSWDAINRLSNTGSGLQWLTGALHLCSPLTSQDIQHLKDWISE TWVNLAMVDYPYASNFLQPLPAWPIKVVCQYLKNPNVSDSLLLQNIFQALNVYYNYSGQVKCLNI SETATSSLGTLGWSYQACTEVVMPFCTNGVDDMFEPHSWNLKELSDDCFQQWGVRPRPSWITTMY GGKNISSHTNIVFSNGELDPWSGGGVTKDITDTLVAVTISEGAHHLDLRTKNALDPMSVLLARSL EVRHMKNWIRDFYDSAGKQHVDHHHHHH
|
| Background |
Lysosomal Pro-X Carboxypeptidase (PRCP) belongs to the peptidase S28 family. PRCP is detected in many tissues, with highest levels observed in placenta, lung, and liver. It is also present in the heart, brain, pancreas, and kidney. PRCP exists as a homodimer. PRCP cleaves C-terminal amino acids linked to proline in peptides such as angiotensin II, III and des-Arg9-bradykinin. This cleavage occurs at acidic pH, but enzymatic activity is retained with some substrates at neutral pH. PRCP has been shown to be an activator of the cell matrix-associated prekallikrein. |
