| Catalog# |
CF87 |
| Source |
E.coli |
| Description |
Recombinant Human BCL2/Adenovirus E1B 19 kDa Protein-Interacting Protein 3/BNIP3 is produced with our E. coli expression system. The target protein is expressed with sequence (Met1-Leu166) of Human BNIP3 fused with a His tag at the N-terminus. |
| Names |
BCL2/Adenovirus E1B 19 kDa Protein-Interacting Protein 3, BNIP3, NIP3 |
| Accession # |
Q12983 |
| Formulation |
Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4 |
| Shipping |
The product is shipped at ambient temperature. |
| Reconstitution |
Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg/ml.
Dissolve the lyophilized protein in 1X PBS.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
| Storage |
Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
| Purity |
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
| Endotoxin |
Less than 0.1 ng/µg (1 IEU/µg). |
| Amino Acid Sequence |
MNHKVHHHHHHMSQNGAPGMQEESLQGSWVELHFSNNGNGGSVPASVSIYNGDMEKILLDAQHES GRSSSKSSHCDSPPRSQTPQDTNRASETDTHSIGEKNSSQSEEDDIERRKEVESILKKNSDWIWD WSSRPENIPPKEFLFKHPKRTATLSMRNTSVMKKGGIFSAEFLKVFLLSRPAV
|
| Background |
BCL2/Adenovirus E1B 19 kDa Protein-Iinteracting Protein 3 (BNIP3) is a single-pass membrane protein. BNIP3 is a member of the NIP3 family. BNIP3 contains a single Bcl-2 homology 3 domain and interacts with the E1B 19 kDa protein. BNIP3 have been associated with pro-apoptotic function. BNIP3 is an apoptosis-inducing protein that can overcome BCL2 suppression. It plays a role in repartitioning calcium between the two major intracellular calcium stores in association with BCL2. BNIP3 involved in mitochondrial quality control via its interaction with SPATA18/MIEAP, response to mitochondrial damage, participates to mitochondrial protein catabolic process. |
