| Catalog# |
C514 |
| Source |
HEK293 |
| Description |
Recombinant Human Butyrophilin Subfamily 1 Member A1/BTN1A1 produced by transfected human cells is a secreted protein with sequence (Ala27-Arg242) of Human BTN1A1 fused with a polyhistidine tag at the C-terminus. |
| Names |
Butyrophilin Subfamily 1 Member A1, BT, BTN1A1, BTN |
| Accession # |
Q13410 |
| Formulation |
Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2 |
| Shipping |
The product is shipped at ambient temperature. |
| Reconstitution |
Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg/ml.
Dissolve the lyophilized protein in 1X PBS.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
| Storage |
Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
| Purity |
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
| Endotoxin |
Less than 0.1 ng/μg (1 IEU/μg). |
| Amino Acid Sequence |
APFDVIGPPEPILAVVGEDAELPCRLSPNASAEHLELRWFRKKVSPAVLVHRDGREQEAEQMPEY RGRATLVQDGIAKGRVALRIRGVRVSDDGEYTCFFREDGSYEEALVHLKVAALGSDPHISMQVQE NGEICLECTSVGWYPEPQVQWRTSKGEKFPSTSESRNPDEEGLFTVAASVIIRDTSAKNVSCYIQ NLLLGQEKKVEISIPASSLPRVDHHHHHH
|
| Background |
Butyrophilin Subfamily 1 Member A1 (BTN1A1) is the major protein associated with fat droplets in the milk. It belongs the immunoglobulin superfamily. BTN1A1 acts as a specific membrane-associated receptor for the association of cytoplasmic droplets with the apical plasma membrane. It is localized to the major histocompatibility complex (MHC) class I region of 6p. It may have arisen relatively recently in evolution by the shuffling of exons between 2 ancestral gene families. It is shown that BTN1A1 inhibits the proliferation of CD4 and CD8 T-cells activated by anti-CD3 antibodies, T-cell metabolism and IL2 and IFNG secretion. |
