| Catalog# |
CF70 |
| Source |
E.coli |
| Description |
Recombinant Human Complement Component 1 Q Subcomponent-Binding Protein Mitochondrial/C1QBP is produced with our E. coli expression system. The target protein is expressed with sequence (Leu74-Gln282) of Human C1QBP fused with a 6His tag at the C-terminus. |
| Names |
Complement Component 1 Q Subcomponent-Binding Protein Mitochondrial, ASF/SF2-Associated Protein p32, Glycoprotein gC1qBP, C1qBP, Hyaluronan-Binding Protein 1, Mitochondrial Matrix Protein p32, gC1q-R Protein, p33, C1QBP, GC1QBP, HABP1, SF2P32 |
| Accession # |
Q07021 |
| Formulation |
Supplied as a 0.2 μm filtered solution of 20mM Tris, 20% Glycerol, 1mM DTT, pH 7.5 |
| Shipping |
The product is shipped on dry ice/ice packs. |
| Storage |
Store at < -20°C, stable for 6 months after receipt.
Please minimize freeze-thaw cycles. |
| Purity |
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
| Endotoxin |
Less than 0.1 ng/μg (1 IEU/μg). |
| Amino Acid Sequence |
MLHTDGDKAFVDFLSDEIKEERKIQKHKTLPKMSGGWELELNGTEAKLVRKVAGEKITVTFNINN SIPPTFDGEEEPSQGQKVEEQEPELTSTPNFVVEVIKNDDGKKALVLDCHYPEDEVGQEDEAESD IFSIREVSFQSTGESEWKDTNYTLNTDSLDWALYDHLMDFLADRGVDNTFADELVELSTALEHQE YITFLEDLKSFVKSQLEHHHHHH
|
| Background |
Complement Component 1Q Subcomponent-Binding Protein (C1QBP) is a nucleus protein that belongs to the MAM33 family. C1QBP is known to bind to the globular heads of C1q molecules and inhibit C1 activation. Mitochondrial C1QBP is a critical mediator of p14ARF-induced apoptosis. C1QBP functions as a chemotactic factor for immature dendritic cells, and migration is mediated through ligation of both C1QBP and cC1qR/CR. C1QBP overexpression successfully blocks mRNA accumulation from the adenovirus major late transcription unit (MLTU) and stimulates RNA polymerase II carboxy-terminal domain phosphorylation in virus-infected cells. |
