| Catalog# |
C805 |
| Source |
HEK293 |
| Description |
Recombinant Human Complement C1q Tumor Necrosis Factor-Related Protein 6/C1QTNF6 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Thr28-Asp259) of Human C1QTNF6 fused with a 6His tag at the C-terminus. |
| Names |
Complement C1q Tumor Necrosis Factor-Related Protein 6, C1QTNF6, CTRP6 |
| Accession # |
Q9BXI9 |
| Formulation |
Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2 |
| Shipping |
The product is shipped at ambient temperature. |
| Reconstitution |
Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg/ml.
Dissolve the lyophilized protein in 1X PBS.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
| Storage |
Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
| Purity |
Greater than 95% as determined by reducing SDS-PAGE. |
| Endotoxin |
Less than 0.1 ng/μg (1 IEU/μg). |
| Amino Acid Sequence |
TFDRAVASGCQRCCDSEDPLDPAHVSSASSSGRPHALPEIRPYINITILKGDKGDPGPMGLPGYM GREGPQGEPGPQGSKGDKGEMGSPGAPCQKRFFAFSVGRKTALHSGEDFQTLLFERVFVNLDGCF DMATGQFAAPLRGIYFFSLNVHSWNYKETYVHIMHNQKEAVILYAQPSERSIMQSQSVMLDLAYG DRVWVRLFKRQRENAIYSNDFDTYITFSGHLIKAEDDVDHHHHHH
|
| Background |
Complement C1q Tumor Necrosis Factor-Related Protein 6 (C1QTNF6) is a secreted protein. C1QTNF6 contains one C1q domain and one collagen-like domain. C1QTNF6 is a collagen type-IV specific for basement membranes. C1QTNF6 is vital for embryonic development. It is reported that C1qTNF6 increases the level of active phosphorylated Akt molecules in cultured vascular endothelial cells via its C-terminal C1q domain. In the xenograft assay, enforced expression of C1qTNF6 markedly reduced the central hypovascular necrosis areas of the transplanted HepG2 hepatocellular carcinoma cells. |
