| Catalog# |
C855 |
| Source |
Human Cells |
| Description |
Recombinant Human Complement C1q and Tumor Necrosis Factor-Related Protein 9/C1QTNF9 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Gln20-Pro333) of Human C1QTNF9 fused with a polyhistidine tag at the C-terminus. |
| Names |
Complement C1q and Tumor Necrosis Factor-Related Protein 9A, Complement C1q and Tumor Necrosis Factor-Related Protein 9, C1QTNF9, C1QTNF9A |
| Accession # |
P0C862 |
| Formulation |
Lyophilized from a 0.2 μm filtered solution of PBS,pH7.4 |
| Shipping |
The product is shipped at ambient temperature. |
| Reconstitution |
Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg/ml.
Dissolve the lyophilized protein in 1X PBS.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
| Storage |
Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
| Purity |
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
| Endotoxin |
Less than 0.1 ng/µg (1 IEU/µg). |
| Amino Acid Sequence |
QDTCRQGHPGIPGNPGHNGLPGRDGRDGAKGDKGDAGEPGRPGSPGKDGTSGEKGERGADGKVEA KGIKGDQGSRGSPGKHGPKGLAGPMGEKGLRGETGPQGQKGNKGDVGPTGPEGPRGNIGPLGPTG LPGPMGPIGKPGPKGEAGPTGPQGEPGVRGIRGWKGDRGEKGKIGETLVLPKSAFTVGLTVLSKF PSSDVPIKFDKILYNEFNHYDTAAGKFTCHIAGVYYFTYHITVFSRNVQVSLVKNGVKILHTKDA YMSSEDQASGGIVLQLKLGDEVWLQVTGGERFNGLFADEDDDTTFTGFLLFSSPVDHHHHHH
|
| Background |
Complement C1q and tumor necrosis factor-related protein 9A is also known as C1QTNF9A, AQL1, CTRP9, C1q and tumor necrosis factor related protein 9. C1QTNF9 is a secreted protein and contains one C1q domain and three collagen-like domains. C1QTNF9 interacts with ADIPOQ via the C1q domain to form a heterotrimeric complex and also interacts with CTRP9B to forms heterotrimers and heterooligomeric complexes with CTRP9B. C1QTNF9 is expressed predominantly in adipose tissue. C1QTNF9 can activates AMPK, AKT, and p44/42 MAPK signaling pathways. |