| Catalog# |
CA45 |
| Source |
HEK293 |
| Description |
Recombinant Human Cadherin 11 Type 2 OB-Cadherin (Osteoblast)/CDH11 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Phe23-Thr617) of Human CDH11 fused with a polyhistidine tag at the C-terminus. |
| Names |
Cadherin 11 Type 2 OB-cadherin (Osteoblast), Cadherin 11 Type 2 OB-Cadherin (Osteoblast) Isoform CRA_c, CDH11 |
| Accession # |
Q96CZ9 |
| Formulation |
Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.4 |
| Shipping |
The product is shipped at ambient temperature. |
| Reconstitution |
Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg/ml.
Dissolve the lyophilized protein in 1X PBS.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
| Storage |
Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
| Purity |
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
| Endotoxin |
Less than 0.1 ng/µg (1 IEU/µg). |
| Amino Acid Sequence |
FAPERRGHLRPSFHGHHEKGKEGQVLQRSKRGWVWNQFFVIEEYTGPDPVLVGRLHSDIDSGDGN IKYILSGEGAGTIFVIDDKSGNIHATKTLDREERAQYTLMAQAVDRDTNRPLEPPSEFIVKVQDI NDNPPEFLHETYHANVPERSNVGTSVIQVTASDADDPTYGNSAKLVYSILEGQPYFSVEAQTGII RTALPNMDREAKEEYHVVIQAKDMGGHMGGLSGTTKVMITLTDVNDNPPKFPQSVYQMSVSEAAV PGEEVGRVKAKDPDIGENGLVTYNIVDGDGMESFEITTDYETQEGVIKLKKPVDFETKRAYSLKV EAANVHIDPKFISNGPFKDTVTVKIAVEDADEPPMFLAPSYIHEVQENAAAGTVVGRVHAKDPDA ANSPIRYSIDRHTDLDRFFTINPEDGFIKTTKPLDREETAWLNITVFAAEIHNRHQEAKVPVAIR VLDVNDNAPKFAAPYEGFICESDQTKPLSNQPIVTISADDKDDTANGPRFIFSLPPEIIHNPNFT VRDNRDNTAGVYARRGGFSRQKQDLYLLPIVISDGGIPPMSSTNTLTIKVCGCDVNGALLSCNAE AYILNAGLSTVDHHHHHH
|
| Background |
Cadherin-11 is a type II classical cadherin member of the cadherin superfamily of integral membrane proteins that mediate calcium-dependent cell-cell adhesion. Cadherins interact with themselves in a homophilic manner in connecting cells, and thus contribute to the sorting of heterogeneous cell types. Cadherin-11 contains five cadherin domains and is mainly expressed in the brain. Mature cadherin proteins consists of a large N-terminal extracellular domain, a single membrane-spanning domain, and a small highly conserved C-terminal cytoplasmic domain. It is shown that Cadherin-11 is a viable molecular target for therapeutic intervention in Glioblastoma multiforme. |
