| Catalog# |
C332 |
| Source |
HEK293 |
| Description |
Recombinant Human Coxsackievirus and Adenovirus Receptor/CAR is produced with our mammalian expression system in human cells. The target protein is expressed with sequence (Leu20-Gly217) of Human CAR fused with a polyhistidine tag at the C-terminus. |
| Names |
Coxsackievirus and Adenovirus Receptor, CAR, hCAR, CVB3-Binding Protein, Coxsackievirus B-Adenovirus Receptor, HCVADR, CXADR, CAR |
| Accession # |
P78310 |
| Formulation |
Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2 |
| Shipping |
The product is shipped at ambient temperature. |
| Reconstitution |
Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg/ml.
Dissolve the lyophilized protein in 1X PBS.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
| Storage |
Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
| Purity |
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
| Endotoxin |
Less than 0.1 ng/μg (1 IEU/μg). |
| Amino Acid Sequence |
LSITTPEEMIEKAKGETAYLPCKFTLSPEDQGPLDIEWLISPADNQKVDQVIILYSGDKIYDDYY PDLKGRVHFTSNDLKSGDASINVTNLQLSDIGTYQCKVKKAPGVANKKIHLVVLVKPSGARCYVD GSEEIGSDFKIKCEPKEGSLPLQYEWQKLSDSQKMPTSWLAEMTSSVISVKNASSEYSGTYSCTV RNRVGSDQCLLRLNVVPPSNKAGVDHHHHHH
|
| Background |
Coxsackievirus and Adenovirus Receptor (CAR) belongs to the CTX family of the Ig superfamily. CXADR is a type I transmembrane glycoprotein and expressed in pancreas, brain, heart, small intestine, testis, prostate. It is a receptor that mediates gene transfer and also act as an adhesion molecule within junctional complexes, notably between epithelial cells lining body cavities and within myocardial intercalated discs. CXADR contains an extracellular domain, a transmembrane helix and a C-terminal intracellular domain. The C-terminal interacts with few cytoplasmic junctional proteins, microtubules and the actin cytoskeleton. |
