| Catalog# |
C399 |
| Source |
HEK293 |
| Description |
Recombinant Human Cathepsin D is produced with our mammalian expression system in human cells. The target protein is expressed with the full length sequence of Human CTSD fused with a polyhistidine tag at the C-terminus. |
| Names |
-His-5 bond in B chain of insulin. It consists of a light chain and a heavy chain and expressed in the aorta extrcellular space. The Val-58 allele is significantly overrepresented in demented patients (11.8%) compared with non-demented controls (4.9%). Ca |
| Accession # |
P07339 |
| Formulation |
Supplied as a 0.2 μm filtered solution of 20mM MES, 150mM NaCl, pH 5.5 |
| Shipping |
The product is shipped on dry ice/ice packs. |
| Storage |
Store at < -20°C, stable for 6 months after receipt.
Please minimize freeze-thaw cycles. |
| Purity |
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
| Endotoxin |
Less than 0.1 ng/µg (1 IEU/µg). |
| Amino Acid Sequence |
SALVRIPLHKFTSIRRTMSEVGGSVEDLIAKGPVSKYSQAVPAVTEGPIPEVLKNYMDAQYYGEI GIGTPPQCFTVVFDTGSSNLWVPSIHCKLLDIACWIHHKYNSDKSSTYVKNGTSFDIHYGSGSLS GYLSQDTVSVPCQSASSASALGGVKVERQVFGEATKQPGITFIAAKFDGILGMAYPRISVNNVLP VFDNLMQQKLVDQNIFSFYLSRDPDAQPGGELMLGGTDSKYYKGSLSYLNVTRKAYWQVHLDQVE VASGLTLCKEGCEAIVDTGTSLMVGPVDEVRELQKAIGAVPLIQGEYMIPCEKVSTLPAITLKLG GKGYKLSPEDYTLKVSQAGKTLCLSGFMGMDIPPPSGPLWILGDVFIGRYYTVFDRDNNRVGFAE AARLVDHHHHHH
|
| Background |
'The protein acid protease active in intracellular protein breakdown and involved in the pathogenesis of several diseases such as breast cancer and possibly Alzheimer disease. It is specificity similar to, but narrower than, that of pepsin A and it does not cleave the 4-Gln- |
