| Catalog# |
CC21 |
| Source |
HEK293 |
| Description |
Recombinant Mouse Cathepsin D is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Ile21-Leu410) of Mouse Cathepsin D fused with a polyhistidine tag at the C-terminus. |
| Names |
Cathepsin D, also known as CTSD and CPSD, is a member of the peptidase A1 family. |
| Accession # |
P18242 |
| Formulation |
Lyophilized from a 0.2 μm filtered solution of 20mM MES,150mM NaCl,pH5.5 |
| Shipping |
The product is shipped at ambient temperature. |
| Reconstitution |
Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg/ml.
Dissolve the lyophilized protein in 1X PBS.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
| Storage |
Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
| Purity |
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
| Endotoxin |
Less than 0.1 ng/µg (1 IEU/µg). |
| Amino Acid Sequence |
IIRIPLRKFTSIRRTMTEVGGSVEDLILKGPITKYSMQSSPKTTEPVSELLKNYLDAQYYGDIGI GTPPQCFTVVFDTGSSNLWVPSIHCKILDIACWVHHKYNSDKSSTYVKNGTSFDIHYGSGSLSGY LSQDTVSVPCKSDQSKARGIKVEKQIFGEATKQPGIVFVAAKFDGILGMGYPHISVNNVLPVFDN LMQQKLVDKNIFSFYLNRDPEGQPGGELMLGGTDSKYYHGELSYLNVTRKAYWQVHMDQLEVGNE LTLCKGGCEAIVDTGTSLLVGPVEEVKELQKAIGAVPLIQGEYMIPCEKVSSLPTVYLKLGGKNY ELHPDKYILKVSQGGKTICLSGFMGMDIPPPSGPLWILGDVFIGSYYTVFDRDNNRVGFANAVVL VDHHHHHH*
|
| Background |
CTSD localizes to the lysosome and consists of a light chain and a heavy chain. CTSD is expressed in epithelial cells as well as in macrophages.CTSD is a lysosomal aspartyl protease that depends critically on protonation of its active site Asp residue and gets activated at pH 5 in endosome of hepatocytes. It has been suggested to facilitate cancer cell migration and invasion by digesting the basement membrane, extracellular matrix and xonnective tissue. In addition, CTSD has been used as a breast cancer tumor marker. |
