| Catalog# |
CD28 |
| Source |
Human Cells |
| Description |
Recombinant Mouse Cathepsin E/Ctse is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Ser60-Pro397) of Mouse Cathepsin E fused with a polyhistidine tag at the C-terminus. |
| Names |
Cathepsin E, ctse, |
| Accession # |
P70269 |
| Formulation |
Supplied as a 0.2 μm filtered solution of 20mM MES, 150mM NaCl, pH5.0 |
| Shipping |
The product is shipped on dry ice/ice packs. |
| Storage |
Store at < -20°C, stable for 6 months after receipt.
Please minimize freeze-thaw cycles. |
| Purity |
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
| Endotoxin |
Less than 0.1 ng/µg (1 IEU/µg). |
| Amino Acid Sequence |
SCNVYSSVNEPLINYLDMEYFGTISIGTPPQNFTVIFDTGSSNLWVPSVYCTSPACKAHPVFHPS QSDTYTEVGNHFSIQYGTGSLTGIIGADQVSVEGLTVDGQQFGESVKEPGQTFVNAEFDGILGLG YPSLAAGGVTPVFDNMMAQNLVALPMFSVYLSSDPQGGSGSELTFGGYDPSHFSGSLNWIPVTKQ AYWQIALDGIQVGDTVMFCSEGCQAIVDTGTSLITGPPDKIKQLQEAIGATPIDGEYAVDCATLD TMPNVTFLINEVSYTLNPTDYILPDLVEGMQFCGSGFQGLDIPPPAGPLWILGDVFIRQFYSVFD RGNNQVGLAPAVPVDHHHHHH
|
| Background |
Cathepsin E is encoded by the ctse gene, exists in the homodimer forms, belongs to the peptidase A1 family. Cathepsin E high expressed in the stomach, clara cells and alveolar macrophages of lung, brain microglia, spleen and activated B-lymphocytes. Cathepsin E may involve in the processing of antigenic peptides during MHC class II-mediated antigen presentation, play a role in activation-induced lymphocyte depletion in the thymus, and in neuronal degeneration and glial cell activation in the brain. |
