| Catalog# |
CD24 |
| Source |
Human Cells |
| Description |
Recombinant Mouse Cathepsin L/Ctsl1 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Thr18-Asn334) of Mouse Cathepsin L fused with a polyhistidine tag at the C-terminus. |
| Names |
Cathepsin L1, Major excreted protein, p39 cysteine proteinase, Ctsl1, |
| Accession # |
P06797 |
| Formulation |
Supplied as a 0.2 μm filtered solution of 20mM Tris,150mM NaCl, pH 7.5 |
| Shipping |
The product is shipped on dry ice/ice packs. |
| Storage |
Store at < -20°C, stable for 6 months after receipt.
Please minimize freeze-thaw cycles. |
| Purity |
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
| Endotoxin |
Less than 0.1 ng/µg (1 IEU/µg). |
| Amino Acid Sequence |
TPKFDQTFSAEWHQWKSTHRRLYGTNEEEWRRAIWEKNMRMIQLHNGEYSNGQHGFSMEMNAFGD MTNEEFRQVVNGYRHQKHKKGRLFQEPLMLKIPKSVDWREKGCVTPVKNQGQCGSCWAFSASGCL EGQMFLKTGKLISLSEQNLVDCSHAQGNQGCNGGLMDFAFQYIKENGGLDSEESYPYEAKDGSCK YRAEFAVANDTGFVDIPQQEKALMKAVATVGPISVAMDASHPSLQFYSSGIYYEPNCSSKNLDHG VLLVGYGYEGTDSNKNKYWLVKNSWGSEWGMEGYIKIAKDRDNHCGLATAASYPVVNVDHHHHHH
|
| Background |
Mouse Cathepsin L is a lysosomal cysteine proteinase which is a member of the peptidase C1 family. This protein is a dimer composed of disulfide-linked heavy and light chains, both produced from a single protein precursor. Cathepsin L plays a major role in intracellular protein catabolism. Its substrates include collagen and elastin, as well as alpha-1 protease inhibitor, a major controlling element of neutrophil elastase activity. Cathepsin L has been implicated in several pathologic processes, including myofibril necrosis in myopathies and in myocardial ischemia, and in the renal tubular response to proteinuria. |
