| Catalog# |
C401 |
| Source |
HEK293 |
| Description |
Recombinant Human Cathepsin L is produced by our mammalian expression system in human cells. The target protein is expressed with the full length sequence of Human Cathepsin L fused with a polyhistidine tag at the C-terminus. |
| Names |
Cathepsin L1, Major Excreted Protein, MEP, CTSL1, CTSL |
| Accession # |
P07711 |
| Formulation |
Supplied as a 0.2 μm filtered solution of 20mM HAc-NaAc, 150mM NaCl, pH 4.5 |
| Shipping |
The product is shipped on dry ice/ice packs. |
| Storage |
Store at < -20°C, stable for 6 months after receipt.
Please minimize freeze-thaw cycles. |
| Purity |
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
| Endotoxin |
Less than 0.1 ng/µg (1 IEU/µg). |
| Amino Acid Sequence |
TLTFDHSLEAQWTKWKAMHNRLYGMNEEGWRRAVWEKNVKMIELHNQEYREGKHSFTMAMNAFGD MTSEEFRQVMNGFQNRKPRKGKVFQEPLFYEAPRSVDWREKGYVTPVKNQGQCGSCWAFSATGAL EGQMFRKTGRLISLSEQNLVDCSGPQGNEGCNGGLMDYAFQYVQDNGGLDSEESYPYEATEESCK YNPKYSVANDTGFVDIPKQEKALMKAVATVGPISVAIDAGHESFLFYKEGIYFEPDCSSEDMDHG VLVVGYGFESTESDNNKYWLVKNSWGEEWGMGGYVKMAKDRRNHCGIASAASYPTVVDHHHHHH
|
| Background |
Cathepsin L is an enzyme. Cathepsin L, a lysosomal endopeptidase expressed in most eukaryotic cells, is a member of the papain-like family of cysteine proteinases. Cathepsin L plays a major role in antigen processing, tumor invasion and metastasis, bone resorption, and turnover of intracellular and secreted proteins involved in growth regulation. Unlike the precursor forms of other papain family members, the 43 kDa pro-cathepsin L itself is secreted from various cells. Pro-cathepsin L is the major excreted protein of malignantly transformed mouse fibroblasts and is also one of the major acidic cysteine proteases in mammalian cells. |
| References |
Allan ER,et al.NADPH Oxidase Modifies Patterns of MHC Class II–Restricted Epitopic Repertoires through Redox Control of Antigen Processing
PMID:24778444
http://www.ncbi.nlm.nih.gov/pubmed/24778444 |
