| Catalog# |
C460 |
| Source |
HEK293 |
| Description |
Recombinant Human Cathepsin L2 produced by transfected human cells is a secreted protein with sequence (Val18-Val334) of Human CTSL2 fused with a polyhistidine tag at the C-terminus. |
| Names |
Cathepsin L2, Cathepsin U, Cathepsin V, CTSL2, CATL2, CTSU, CTSV |
| Accession # |
O60911 |
| Formulation |
Supplied as a 0.2 μm filtered solution of 20mM MES, 150mM NaCl, pH 5.5 |
| Shipping |
The product is shipped on dry ice/ice packs. |
| Storage |
Store at < -20°C, stable for 6 months after receipt.
Please minimize freeze-thaw cycles. |
| Purity |
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
| Endotoxin |
Less than 0.1 ng/µg (1 IEU/µg). |
| Amino Acid Sequence |
VPKFDQNLDTKWYQWKATHRRLYGANEEGWRRAVWEKNMKMIELHNGEYSQGKHGFTMAMNAFGD MTNEEFRQMMGCFRNQKFRKGKVFREPLFLDLPKSVDWRKKGYVTPVKNQKQCGSCWAFSATGAL EGQMFRKTGKLVSLSEQNLVDCSRPQGNQGCNGGFMARAFQYVKENGGLDSEESYPYVAVDEICK YRPENSVANDTGFTVVAPGKEKALMKAVATVGPISVAMDAGHSSFQFYKSGIYFEPDCSSKNLDH GVLVVGYGFEGANSNNSKYWLVKNSWGPEWGSNGYVKIAKDKNNHCGIATAASYPNVVDHHHHHH
|
| Background |
'Cathepsin L2 belongs to the Peptidase C1 family. Cathepsin L2 can be autocatalytically converted to the mature form as a proenzyme in lysosomes at pH=7.0. Cathepsin L2 cannot be expressed in normal mammary gland, colon and peritumoral tissue, but it can be expressed in breast carcinomas and colorectal tissues. These suggeats Cathepsin L2 may play a role in tumor processes. Cathepsin L2 is specifically expressed in the testis, thymus, and corneal epithelium.' |
