| Catalog# |
CF38 |
| Source |
E.coli |
| Description |
Recombinant Human C-C Motif Chemokine 18/CCL18 is produced with our E. coli expression system. The target protein is expressed with sequence (Ala21-Ala89) of Human CCL18 fused with a 6His tag at the N-terminus. |
| Names |
C-C Motif Chemokine 18, Alternative Macrophage Activation-Associated CC Chemokine 1, AMAC-1, CC Chemokine PARC, Dendritic Cell Chemokine 1, DC-CK1, Macrophage Inflammatory Protein 4, MIP-4, Pulmonary and Activation-Regulated Chemokine, Small-Inducible Cyt |
| Accession # |
P55774 |
| Formulation |
Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4 |
| Shipping |
The product is shipped at ambient temperature. |
| Reconstitution |
Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg/ml.
Dissolve the lyophilized protein in 1X PBS.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
| Storage |
Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
| Purity |
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
| Endotoxin |
Less than 0.1 ng/µg (1 IEU/µg). |
| Amino Acid Sequence |
MGSSHHHHHHSSGLVPRGSHMAQVGTNKELCCLVYTSWQIPQKFIVDYSETSPQCPKPGVILLTK RGRQICADPNKKWVQKYISDLKLNA
|
| Background |
C-C Motif Chemokine 18 (CCL18) is secreted protein that belongs to the intercrine beta (chemokine CC) family. CCL18 is expressed at high levels in the lung, lymph nodes, placenta, bone marrow, and dendritic cells. CCL18 is a chemotactic factor that attracts lymphocytes but not monocytes or granulocytes. CCL18 may be involved in B-cell migration into B-cell follicles in lymph nodes. CCL18 attracts naive T-lymphocytes toward dendritic cells and activated macrophages in lymph nodes. It has chemotactic activity for naive T-cells, CD4+ and CD8+ T-cells and thus may play a role in both humoral and cell-mediated immunity responses. |
