| Catalog# |
C979 |
| Source |
HEK293 |
| Description |
Recombinant Human C-C Motif Chemokine 21/CCL21 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Ser24-Pro134) of Human CCL21 fused with a 6His tag at the C-terminus. |
| Names |
C-C Motif Chemokine 21, 6Ckine, Beta-Chemokine Exodus-2, Secondary Lymphoid-Tissue Chemokine, SLC, Small-Inducible Cytokine A21, CCL21, SCYA21 |
| Accession # |
O00585 |
| Shipping |
The product is shipped at ambient temperature. |
| Storage |
Store at < -20°C, stable for 6 months after receipt.
Please minimize freeze-thaw cycles. |
| Purity |
Greater than 95% as determined by reducing SDS-PAGE. |
| Endotoxin |
Less than 0.1 ng/μg (1 IEU/μg). |
| Amino Acid Sequence |
SDGGAQDCCLKYSQRKIPAKVVRSYRKQEPSLGCSIPAILFLPRKRSQAELCADPKELWVQQLMQ HLDKTPSPQKPAQGCRKDRGASKTGKKGKGSKGCKRTERSQTPKGPVDHHHHHH
|
| Background |
C-C Motif Chemokine 21 (CCL21) belongs to the intercrine β (chemokine CC) family. It is highly expressed in peripheral blood leukocytes, pancreas, and liver, with moderate levels in the thymus, spleen and lung, and low expression levels in the small intestine, placenta, and prostate. CCL21 elicits its effects by binding to a cell surface chemokine receptor known as CCR7. CCL21 shows preferential activity towards naive T-cells. CCL21 may play a role in mediating homing of lymphocytes to secondary lymphoid organs. |
