| Catalog# |
CC43 |
| Source |
HEK293 |
| Description |
Recombinant Human CCL24/Eotaxin-2/MPIF-2 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Val27-Cys119) of Human CCL24 fused with a polyhistidine tag at the C-terminus. |
| Names |
C-C motif chemokine 24 (CCL24), also known as CK-beta-6, Eosinophil chemotactic protein, Eotaxin-2, Myeloid progenitor inhibitory factor 2, Small-inducible cytokine A24, Ckb-6, MPIF-2 and SCYA24, belongs to the intercrine beta (chemokine CC) family. |
| Accession # |
O00175 |
| Formulation |
Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.2 |
| Shipping |
The product is shipped at ambient temperature. |
| Reconstitution |
Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg/ml.
Dissolve the lyophilized protein in 1X PBS.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
| Storage |
Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
| Purity |
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
| Endotoxin |
Less than 0.1 ng/µg (1 IEU/µg). |
| Amino Acid Sequence |
VVIPSPCCMFFVSKRIPENRVVSYQLSSRSTCLKAGVIFTTKKGQQFCGDPKQEWVQRYMKNLDA KQKKASPRARAVAVKGPVQRYPGNQTTCVDHHHHHH*
|
| Background |
Cytokine are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteine. CCL24 diaplays the chemotactic for resting T-lymphocytes and eosinophils. CCL24 has lower chemotatic activity for neutrophils, none for monocytes and activated lymphocytes. CCL24 is a strong suppressor of colony formation by a multipotential hematopoietic progenitor cell lines. |
