| Catalog# |
C065 |
| Source |
E.coli |
| Description |
Recombinant Human C-C Motif Chemokine 27/CCL27 produced by E. coli is a single non-glycosylated polypeptide chain containing 88 amino acids with a molecular mass of 10.1 kD. |
| Names |
C-C Motif Chemokine 27, CC Chemokine ILC, Cutaneous T-Cell-Attracting Chemokine, CTACK, Eskine, IL-11 R-Alpha-Locus Chemokine, Skinkine, Small-Inducible Cytokine A27, CCL27, ILC, SCYA27 |
| Accession # |
Q9Y4X3 |
| Formulation |
Lyophilized from a 0.2 μm filtered solution of 20mM PB, 500mM NaCl, pH 7.5 |
| Shipping |
The product is shipped at ambient temperature. |
| Reconstitution |
Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg/ml.
Dissolve the lyophilized protein in 1X PBS.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
| Storage |
Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
| Purity |
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
| Endotoxin |
Less than 0.1 ng/μg (1 IEU/μg). |
| Amino Acid Sequence |
FLLPPSTACCTQLYRKPLSDKLLRKVIQVELQEADGDCHLQAFVLHLAQRSICIHPQNPSLSQWF EHQERKLHGTLPKLNFGMLRKMG
|
| Background |
Human Chemokine (C-C Motif) Ligand 27 (CCL27) is a small cytokine that is a member of the CC chemokine family; it is expressed in numerous tissues, including gonads, thymus, placenta and skin. CCL27 elicits its chemotactic effects by binding to the chemokine receptor CCR10. Predominantly expressed in the skin, CCL27 is associated with T cell-mediated inflammation of the skin. Human and Mouse CCL27 share 84% sequence identity in the mature form. |
