| Catalog# |
C569 |
| Source |
HEK293 |
| Description |
Recombinant Human C-C Motif Chemokine 4/CCL4 is produced with our mammalian expression system in human cells. The target protein is expressed with sequence (Ala24-Asn92) of Human CCL4 fused with a polyhistidine tag at the C-terminus. |
| Names |
C-C Motif Chemokine 4, G-26 T-Lymphocyte-Secreted Protein, HC21, Lymphocyte Activation Gene 1 Protein, LAG-1, MIP-1-Beta(1-69), Macrophage Inflammatory Protein 1-Beta, MIP-1-Beta, PAT 744, Protein H400, SIS-Gamma, Small-Inducible Cytokine A4, T-Cell Activ |
| Accession # |
P13236 |
| Formulation |
Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, 5% Threhalose, pH 7.5 |
| Shipping |
The product is shipped at ambient temperature. |
| Reconstitution |
Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg/ml.
Dissolve the lyophilized protein in 1X PBS.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
| Storage |
Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
| Purity |
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
| Endotoxin |
Less than 0.1 ng/μg (1 IEU/μg). |
| Amino Acid Sequence |
APMGSDPPTACCFSYTARKLPRNFVVDYYETSSLCSQPAVVFQTKRSKQVCADPSETWVQEYVYD LELNVDHHHHHH
|
| Background |
C-C Motif Chemokine 4 (CCL4) is a secreted protein which belongs to the intercrine beta (chemokine CC) family. CCL4 is a chemoattractant for natural killer cells, monocytes and a variety of other immune cells. CCL4 is a major HIV-suppressive factor produced by CD8+ T cells. Recombinant CCL4 induces a dose-dependent inhibition of different strains of HIV-1, HIV-2, and simian immunodeficiency virus (SIV). The processed form CCL4 (3-69) retains the abilities to induce down-modulation of surface expression of the chemokine receptor CCR5 and to inhibit the CCR5-mediated entry of HIV-1 in T-cells. CCL4 (3-69) is also a ligand for CCR1 and CCR2 isoform B. |
