| Catalog# |
C571 |
| Source |
HEK293 |
| Description |
Recombinant Human CD164 is produced with mammalian expression system in human cells. The target protein is expressed with sequence (Asp24-Thr160) of Human CD164 fused with a polyhistidine tag at the C-terminus. |
| Names |
Sialomucin Core Protein 24, MUC-24, Endolyn, Multi-Glycosylated Core Protein 24, MGC-24, MGC-24v, CD164 |
| Accession # |
Q04900 |
| Formulation |
Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2 |
| Shipping |
The product is shipped at ambient temperature. |
| Reconstitution |
Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg/ml.
Dissolve the lyophilized protein in 1X PBS.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
| Storage |
Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
| Purity |
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
| Endotoxin |
Less than 0.1 ng/μg (1 IEU/μg). |
| Amino Acid Sequence |
DKNTTQHPNVTTLAPISNVTSAPVTSLPLVTTPAPETCEGRNSCVSCFNVSVVNTTCFWIECKDE SYCSHNSTVSDCQVGNTTDFCSVSTATPVPTANSTAKPTVQPSPSTTSKTVTTSGTTNNTVTPTS QPVRKSTVDHHHHHH
|
| Background |
CD164 is a single-pass type I membrane protein that belongs to the CD164 family. CD164 is up-regulated by CXCL12 in prostate cancer cell lines. CD164 may play a key role in hematopoiesis by facilitating the adhesion of CD34+ cells to the stroma and by negatively regulating CD34+CD38 (lo/-) cell proliferation. CD164 modulates the migration of umbilical cord blood CD133+ cells and this is mediated through the CXCL12/CXCR4 axis. CD164 may play an important role in prostate cancer metastasis and the infiltration of bone marrow by cancer cells. CD164 promotes myogenesis by enhancing CXCR4-dependent cell motility. CD164 also positively regulates myoblast migration and promotes myoblast fusion into myotubes. |
