| Catalog# |
C442 |
| Source |
HEK293 |
| Description |
Recombinant Human CD177 is produced with our mammalian expression system in human cells. The target protein is expressed with sequence (Leu22-Gly407) of Human CD177 fused with a polyhistidine tag at the C-terminus. |
| Names |
CD177 Antigen, Human Neutrophil Alloantigen 2a, HNA-2a, NB1 Glycoprotein, NB1 GP, Polycythemia Rubra Vera Protein 1, PRV-1, CD177, NB1, PRV1 |
| Accession # |
Q8N6Q3 |
| Formulation |
Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2 |
| Shipping |
The product is shipped at ambient temperature. |
| Reconstitution |
Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg/ml.
Dissolve the lyophilized protein in 1X PBS.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
| Storage |
Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
| Purity |
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
| Endotoxin |
Less than 0.1 ng/μg (1 IEU/μg). |
| Amino Acid Sequence |
LLCQFGTVQHVWKVSDLPRQWTPKNTSCDSGLGCQDTLMLIESGPQVSLVLSKGCTEAKDQEPRV TEHRMGPGLSLISYTFVCRQEDFCNNLVNSLPLWAPQPPADPGSLRCPVCLSMEGCLEGTTEEIC PKGTTHCYDGLLRLRGGGIFSNLRVQGCMPQPGCNLLNGTQEIGPVGMTENCNRKDFLTCHRGTT IMTHGNLAQEPTDWTTSNTEMCEVGQVCQETLLLLDVGLTSTLVGTKGCSTVGAQNSQKTTIHSA PPGVLVASYTHFCSSDLCNSASSSSVLLNSLPPQAAPVPGDRQCPTCVQPLGTCSSGSPRMTCPR GTTHCYDGYIHLSGGGLSTKMSIQGCVAQPSSFLLNHTRQIGIFSAREKRDVQPPASQHEGVDHH HHHH
|
| Background |
CD177 is polymorphic and has at least two alleles: PRV1 and NB1. Human PRV1 is a Glycosyl-Phosphatidylinositol (GPI)-linked cell surface glycoprotein that belongs to the uPAR/CD59/Ly6 family of receptors. PRV1 is expressed by neutrophils and neutrophil precursors,and changes in expression serve as diagnostic markers for myeloproliferative disorders such as polycythemia vera and essential thrombocythemia. PRV1 may also be expressed by Erythroblasts, B cells, and Monocytes. NB1, a Glycosyl-Phosphatidylinositol (GPI)-linked cell surface glycoprotein, was first described in a case of neonatal alloimmune neutropenia. It is reported that CD177 functions as a novel heterophilic binding partner that engages PECAM-1 in membrane-proximal IgD6. |
