| Catalog# |
CC99 |
| Source |
HEK293 |
| Description |
Recombinant Human T-cell surface antigen CD2/CD2 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Lys25-Asp209) of Human CD2 fused with a polyhistidine tag at the C-terminus. |
| Names |
T-cell surface antigen CD2 is also known as Erythrocyte receptor, LFA-2, LFA-3 receptor, Rosette receptor, T-cell surface antigen T11/Leu-5. |
| Accession # |
P06729 |
| Formulation |
Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.4 |
| Shipping |
The product is shipped at ambient temperature. |
| Reconstitution |
Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg/ml.
Dissolve the lyophilized protein in 1X PBS.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
| Storage |
Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
| Purity |
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
| Endotoxin |
Less than 0.1 ng/µg (1 IEU/µg). |
| Amino Acid Sequence |
KEITNALETWGALGQDINLDIPSFQMSDDIDDIKWEKTSDKKKIAQFRKEKETFKEKDTYKLFKN GTLKIKHLKTDDQDIYKVSIYDTKGKNVLEKIFDLKIQERVSKPKISWTCINTTLTCEVMNGTDP ELNLYQDGKHLKLSQRVITHKWTTSLSAKFKCTAGNKVSKESSVEPVSCPEKGLDVDHHHHHH
|
| Background |
T-cell surface antigen CD2 is also known as Erythrocyte receptor, LFA-2, LFA-3 receptor, Rosette receptor, T-cell surface antigen T11/Leu-5. It is a protein that in humans is encoded by the CD2 gene. It is a single-pass type I membrane protein. contains 1 Ig-like C2-type domain and 1 Ig-like V-type domain. T-cell surface antigen CD2 interacts with lymphocyte function-associated antigen (LFA-3) and CD48/BCM1 to mediate adhesion between T-cells and other cell types. It is implicated in the triggering of T-cells, the cytoplasmic domain is implicated in the signaling function. |
