| Catalog# |
C314 |
| Source |
HEK293 |
| Description |
Recombinant Human CD27 produced by transfected human cells is a secreted protein with sequence (Ala20-Arg191) of Human CD27 fused with a polyhistidine tag at the C-terminus. |
| Names |
CD27 Antigen, CD27L Receptor, T-Cell Activation Antigen CD27, T14, Tumor Necrosis Factor Receptor Superfamily Member 7, CD27, CD27, TNFRSF7 |
| Accession # |
P26842 |
| Formulation |
Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.4 |
| Shipping |
The product is shipped at ambient temperature. |
| Reconstitution |
Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg/ml.
Dissolve the lyophilized protein in 1X PBS.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
| Storage |
Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
| Purity |
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
| Endotoxin |
Less than 0.1 ng/μg (1 IEU/μg). |
| Amino Acid Sequence |
ATPAPKSCPERHYWAQGKLCCQMCEPGTFLVKDCDQHRKAAQCDPCIPGVSFSPDHHTRPHCESC RHCNSGLLVRNCTITANAECACRNGWQCRDKECTECDPLPNPSLTARSSQALSPHPQPTHLPYVS EMLEARTAGHMQTLADFRQLPARTLSTHWPPQRSLCSSDFIRIVDHHHHHH
|
