| Catalog# |
C579 |
| Source |
HEK293 |
| Description |
Recombinant Human CD44 is produced with our mammalian expression system in human cells. The target protein is expressed with sequence (Gln21-Pro220) of Human CD44 fused with a polyhistidine tag at the C-terminus. |
| Names |
CD44 Antigen, CDw44, Epican, Extracellular Matrix Receptor III, ECMR-III, GP90 Lymphocyte Homing/Adhesion Receptor, HUTCH-I, Heparan Sulfate Proteoglycan, Hermes Antigen, Hyaluronate Receptor, Phagocytic Glycoprotein 1, PGP-1, Phagocytic Glycoprotein I, P |
| Accession # |
P16070 |
| Formulation |
Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2 |
| Shipping |
The product is shipped at ambient temperature. |
| Reconstitution |
Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg/ml.
Dissolve the lyophilized protein in 1X PBS.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
| Storage |
Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
| Purity |
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
| Endotoxin |
Less than 0.1 ng/μg (1 IEU/μg). |
| Amino Acid Sequence |
QIDLNITCRFAGVFHVEKNGRYSISRTEAADLCKAFNSTLPTMAQMEKALSIGFETCRYGFIEGH VVIPRIHPNSICAANNTGVYILTSNTSQYDTYCFNASAPPEEDCTSVTDLPNAFDGPITITIVNR DGTRYVQKGEYRTNPEDIYPSNPTDDDVSSGSSSERSSTSGGYIFYTFSTVHPIPDEDSPWITDS TDRIPVDHHHHHH
|
| Background |
CD44 is a cell-surface receptor for hyaluronic acid and also interacts with other ligands, such as osteopontin, collagens, and matrix metalloproteinases. A large number of CD44 isoforms can be generated by the insertion of different combinations of at least nine exons. Increased CD44 antigen is associated with relapses in non-small cell lung cancers. Furthermore, an increasing quantity of evidence suggests that CD44 has various functions related to inflammatory disease. CD44 deficiency induces severe liver injury. CD44-hyaluronate mediates in lymphocyte T and monocyte adhesion to the endothelium, stimulates proinflammatory cytokine release from macrophages and participates in dedifferentiation phenotype of smooth muscle cells from contractile state to synthetic one. |
