| Catalog# |
C320 |
| Source |
HEK293 |
| Description |
Recombinant Human CD46 is produced with our mammalian expression system in human cells. The target protein is expressed with sequence (Cys35-Asp328) of Human CD46 fused with a polyhistidine tag at the C-terminus. |
| Names |
Membrane Cofactor Protein, TLX, Trophoblast Leukocyte Common Antigen, CD46, MCP, MIC10 |
| Accession # |
P15529 |
| Formulation |
Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.4 |
| Shipping |
The product is shipped at ambient temperature. |
| Reconstitution |
Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg/ml.
Dissolve the lyophilized protein in 1X PBS.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
| Storage |
Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
| Purity |
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
| Endotoxin |
Less than 0.1 ng/μg (1 IEU/μg). |
| Amino Acid Sequence |
CEEPPTFEAMELIGKPKPYYEIGERVDYKCKKGYFYIPPLATHTICDRNHTWLPVSDDACYRETC PYIRDPLNGQAVPANGTYEFGYQMHFICNEGYYLIGEEILYCELKGSVAIWSGKPPICEKVLCTP PPKIKNGKHTFSEVEVFEYLDAVTYSCDPAPGPDPFSLIGESTIYCGDNSVWSRAAPECKVVKCR FPVVENGKQISGFGKKFYYKATVMFECDKGFYLDGSDTIVCDSNSTWDPPVPKCLKVSTSSTTKS PASSASGPRPTYKPPVSNYPGYPKPEEGILDSLDLDHHHHHH
|
| Background |
CD46 is a type I membrane protein containing four Sushi domains. CD46 is expressed by all cells except erythrocytes. CD46 has cofactor activity for inactivation of complement components C3b and C4b by serum factor I, which protects the host cell from damage by complement. It may be involved in the fusion of the spermatozoa with the oocyte during fertilization. CD46 also acts as a costimulatory factor for T-cells which induces the differentiation of CD4+ into T-regulatory 1 cells. T-regulatory 1 cells suppress immune responses by secreting interleukin-10, and therefore are thought to prevent autoimmunity. A number of viral and bacterial pathogens exploit this property and directly induce an immunosuppressive phenotype in T-cells by binding to CD46. CD46 acts as a receptor for the Edmonston strain of measles virus, human herpesvirus-6, and type IV pili of pathogenic Neisseria. |
