| Catalog# |
CF13 |
| Source |
E.coli |
| Description |
Recombinant Human B-Cell Differentiation Antigen CD72/CD72 is produced with our E. coli expression system. The target protein is expressed with sequence (Arg117-Cys226) of Human CD72. |
| Names |
B-Cell Differentiation Antigen CD72, Lyb-2, CD72 |
| Accession # |
P21854 |
| Formulation |
Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4 |
| Shipping |
The product is shipped at ambient temperature. |
| Reconstitution |
Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg/ml.
Dissolve the lyophilized protein in 1X PBS.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
| Storage |
Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
| Purity |
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
| Endotoxin |
Less than 0.1 ng/µg (1 IEU/µg). |
| Amino Acid Sequence |
MSDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNP GTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLAGSGSGHMHHHHHHSSGLVPRG SGMKETAAAKFERQHMDSPDLGTDDDDKAMADIGSMRYLQVSQQLQQTNRVLEVTNSSLRQQLRL KITQLGQSAEDLQGSRRELAQSQEALQVEQRAHQAAEGQLQACQADRQKTKETLQSEEQQRRALE QKLSNMENRLKPFFTC
|
| Background |
B-Cell Differentiation Antigen CD72 (CD72) is a single-pass type II membrane protein. CD72 exists as a disulfide-linked homodimer and contains one C-type lectin domain. CD72 is expressed on B lineage cells, NK cells, monocytes, dendritic cells, and mast cells. CD72 is a ligand for CD5. CD72 associates with CD5, interacts with PTPN6/SHP-1 and plays a role in B-cell proliferation and differentiation. CD72 associates with CD79A in the B cell antigen receptor (BCR) complex following antigen stimulation and dampens BCR signaling through interactions with the phosphatase SHP-1. |
