| Catalog# |
CE45 |
| Source |
E.coli |
| Description |
Recombinant Human Parafibromin is produced by our E. coli expression system. The target protein is expressed with sequence (Met1-Glu260) of Human CDC73 fused with a 6His tag at the N-terminus. |
| Names |
Parafibromin, Cell Division Cycle Protein 73 Homolog, Hyperparathyroidism 2 Protein, CDC73, C1orf28, HRPT2 |
| Accession # |
Q6P1J9 |
| Formulation |
Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.4 |
| Shipping |
The product is shipped at ambient temperature. |
| Reconstitution |
Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg/ml.
Dissolve the lyophilized protein in 1X PBS.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
| Storage |
Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
| Biological Activity |
IN STOCK |
| Purity |
Greater than 95% as determined by reducing SDS-PAGE. |
| Endotoxin |
Less than 0.1 ng/µg (1 IEU/µg). |
| Amino Acid Sequence |
MGSSHHHHHHSSGLVPRGSHMADVLSVLRQYNIQKKEIVVKGDEVIFGEFSWPKNVKTNYVVWGT GKEGQPREYYTLDSILFLLNNVHLSHPVYVRRAATENIPVVRRPDRKDLLGYLNGEASTSASIDR SAPLEIGLQRSTQVKRAADEVLAEAKKPRIEDEECVRLDKERLAARLEGHKEGIVQTEQIRSLSE AMSVEKIAAIKAKIMAKKRSTIKTDLDDDITALKQRSFVDAEVDVTRDIVSRERVWRTRTTILQS TGKNFSKNIFAILQSVKARELEHHHHHH
|
| Background |
Parafibromin is expressed in the adrenal and parathyroid glands, kidney, and heart. As a tumor supressor, Parafibromin may be involved in transcriptional and post-transcriptional control pathways, also through the regulation of cyclin D1/PRAD1 expression, involved the cell cycle progression. Parafibromin is a component of the the PAF protein complex and interacts with a Set1-like complex that has histone methyltransferase activity and methylates histone H3. Defects in Parafibromin can cause hyperparathyroidism-jaw tumor syndrome, familial isolated hyperparathyroidism, and parathyroid carcinoma. |
