| Catalog# |
C977 |
| Source |
Human Cells |
| Description |
Recombinant Human Cyclin-Dependent Kinase 2-Associated Protein 1/CDK2AP1 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Met1-Ser115) of Human CDK2AP1 fused with a 6His tag at the C-terminus. |
| Names |
Cyclin-Dependent Kinase 2-Associated Protein 1, CDK2-Associated Protein 1, Deleted in Oral Cancer 1, DOC-1, Putative Oral Cancer Suppressor, CDK2AP1, CDKAP1, DOC1 |
| Accession # |
O14519 |
| Formulation |
Lyophilized from a 0.2 μm filtered solution of 20mM Tris,150mM NACl,pH 8.0 |
| Shipping |
The product is shipped at ambient temperature. |
| Reconstitution |
Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg/ml.
Dissolve the lyophilized protein in 1X PBS.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
| Storage |
Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
| Purity |
Greater than 95% as determined by reducing SDS-PAGE. |
| Endotoxin |
Less than 0.1 ng/µg (1 IEU/µg). |
| Amino Acid Sequence |
MSYKPNLAAHMPAAALNAAGSVHSPSTSMATSSQYRQLLSDYGPPSLGYTQGTGNSQVPQSKYAE LLAIIEELGKEIRPTYAGSKSAMERLKRGIIHARGLVRECLAETERNARSVDHHHHHH
|
| Background |
Cyclin-Dependent Kinase 2-Associated Protein 1 (CDK2AP1) is a member of the CDK2AP family. The homodimeric structure of CDK2AP1 includes an intrinsically disordered 60-residue N-terminal region and a four-helix bundle dimeric structure with reduced Cys-105 in the C-terminal region. The widely expressed CDK2AP1 protein is the only known specific inhibitor of CDK2, making it an important component of cell cycle regulation during G(1)-to-S phase transition. In addition, CDK2AP1 serves as a regulatory role in DNA replication during S phase of the cell cycle. |
