| Catalog# |
CA04 |
| Source |
HEK293 |
| Description |
Recombinant Human Chondroadherin/CHAD is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Cys23-His359) of Human CHAD fused with a polyhistidine tag at the C-terminus. |
| Names |
Chondroadherin, Cartilage Leucine-Rich Protein, CHAD, SLRR4A |
| Accession # |
O15335 |
| Formulation |
Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.4 |
| Shipping |
The product is shipped at ambient temperature. |
| Storage |
Store at < -20°C, stable for 6 months after receipt.
Please minimize freeze-thaw cycles. |
| Purity |
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
| Endotoxin |
Less than 0.1 ng/μg (1 IEU/μg). |
| Amino Acid Sequence |
CPQNCHCHSDLQHVICDKVGLQKIPKVSEKTKLLNLQRNNFPVLAANSFRAMPNLVSLHLQHCQI REVAAGAFRGLKQLIYLYLSHNDIRVLRAGAFDDLTELTYLYLDHNKVTELPRGLLSPLVNLFIL QLNNNKIRELRAGAFQGAKDLRWLYLSENALSSLQPGALDDVENLAKFHVDRNQLSSYPSAALSK LRVVEELKLSHNPLKSIPDNAFQSFGRYLETLWLDNTNLEKFSDGAFLGVTTLKHVHLENNRLNQ LPSNFPFDSLETLALTNNPWKCTCQLRGLRRWLEAKASRPDATCASPAKFKGQHIRDTDAFRSCK FPTKRSKKAGRHVDHHHHHH
|
| Background |
Chondroadherin is a secreted protein that belongs to the small leucine-rich proteoglycan (SLRP) family of SLRP class IV subfamily. Chondroadherin contains one LRRCT domain, one LRRNT domain, and nine LRR (leucine-rich) repeats. It presents in chondrocytes at all ages. Chondroadherin is initially found as a 36-kD matrix protein isolated from bovine cartilage. It is shown to mediate chondrocyte-matrix interactions. Chondroadherin promotes attachment of chondrocytes, fibroblasts, and osteoblasts. This binding is mediated (at least for chondrocytes and fibroblasts) by the integrin α2β1. Chondroadherin may play an important role in the regulation of chondrocyte growth and proliferation. |
