| Catalog# |
C589 |
| Source |
HEK293 |
| Description |
Recombinant Human Chymase/CMA1 is produced with our mammalian expression system in human cells. The target protein is expressed with sequence (Ile22-Asn247) of Human CMA1 fused with a polyhistidine tag at the C-terminus. |
| Names |
Chymase, Alpha-Chymase, Mast Cell Protease I, CMA1, CYH, CYM |
| Accession # |
P23946 |
| Formulation |
Supplied as a 0.2 μm filtered solution of 20mM HEPES, 150mM KCl, pH 7.5 |
| Shipping |
The product is shipped on dry ice/ice packs. |
| Storage |
Store at < -20°C, stable for 6 months after receipt.
Please minimize freeze-thaw cycles. |
| Purity |
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
| Endotoxin |
Less than 0.1 ng/μg (1 IEU/μg). |
| Amino Acid Sequence |
GEIIGGTECKPHSRPYMAYLEIVTSNGPSKFCGGFLIRRNFVLTAAHCAGRSITVTLGAHNITEE EDTWQKLEVIKQFRHPKYNTSTLHHDIMLLKLKEKASLTLAVGTLPFPSQFNFVPPGRMCRVAGW GRTGVLKPGSDTLQEVKLRLMDPQACSHFRDFDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGVAQ GIVSYGRSDAKPPAVFTRISHYRPWINQILQANVDHHHHHH
|
| Background |
Chymases are a family of chymotrysin-like serine proteases that are found primarily in mast cells, though also present in basophil granulocytes. They are synthesized as inactive precursors containing a 2-residue propeptide, which needs to be removed by Dipeptidyl Pepdidase I/Cathepsin C for enzymatic activity. They show broad peptidolytic activity and are involved in a variety of functions. For example, chymases are released by mucosal mast cells upon challenge with parasites and parasite antigens promoting an inflammatory response. Chymases are also known to convert Angiotensin I to Angiotensin II and thus play a role in hypertension and atherosclerosis. Due to its role in inflammation it has been investigated as a target in the treatment of asthma. |
