| Catalog# |
CG87 |
| Source |
E.coli |
| Description |
Recombinant Human Copine-1/CPNE1 is produced with our E. coli expression system. The target protein is expressed with sequence (Met1-Ala537) of Human CPNE1 fused with a 6His tag at the N-terminus and a 6His tag at the C-terminus. |
| Names |
Copine-1, Copine I, CPN1, CPNE1 |
| Accession # |
Q99829 |
| Formulation |
Lyophilized from a 0.2 μm filtered solution of PBS，pH 7.4 |
| Shipping |
The product is shipped at ambient temperature. |
| Reconstitution |
Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg/ml.
Dissolve the lyophilized protein in 1X PBS.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
| Storage |
Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
| Purity |
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
| Endotoxin |
Less than 0.1 ng/µg (1 IEU/µg). |
| Amino Acid Sequence |
MGSSHHHHHHSSGLVPRGSHMAHCVTLVQLSISCDHLIDKDIGSKSDPLCVLLQDVGGGSWAELG RTERVRNCSSPEFSKTLQLEYRFETVQKLRFGIYDIDNKTPELRDDDFLGGAECSLGQIVSSQVL TLPLMLKPGKPAGRGTITVSAQELKDNRVVTMEVEARNLDKKDFLGKSDPFLEFFRQGDGKWHLV YRSEVIKNNLNPTWKRFSVPVQHFCGGNPSTPIQVQCSDYDSDGSHDLIGTFHTSLAQLQAVPAE FECIHPEKQQKKKSYKNSGTIRVKICRVETEYSFLDYVMGGCQINFTVGVDFTGSNGDPSSPDSL HYLSPTGVNEYLMALWSVGSVVQDYDSDKLFPAFGFGAQVPPDWQVSHEFALNFNPSNPYCAGIQ GIVDAYRQALPQVRLYGPTNFAPIINHVARFAAQAAHQGTASQYFMLLLLTDGAVTDVEATREAV VRASNLPMSVIIVGVGGADFEAMEQLDADGGPLHTRSGQAAARDIVQFVPYRRFQNAPREALAQT VLAEVPTQLVSYFRAQGWAPLKPLPPSAKDPAQAPQALEHHHHHH
|
| Background |
Copine-1(CPNE1) encodes a calcium-dependent protein which belongs to the copine family. CPNE1contains two N-terminal type II C2 domains and an integrin A domain-like sequence in the C-terminus. However, CPNE1 does not contain a predicted signal sequence or transmembrane domains. CPNE1 may regulate molecular events at the interface of the cell membrane and cytoplasm. CPNE1 has a broad tissue distribution and it may function in membrane trafficking. |
