| Catalog# |
CF64 |
| Source |
E.coli |
| Description |
Recombinant Human Death Domain-Containing Protein CRADD/CRADD is produced with our E. coli expression system. The target protein is expressed with sequence (Met1-Glu199) of Human CRADD. |
| Names |
Death Domain-Containing Protein CRADD, Caspase and RIP Adapter with Death Domain, RIP-Associated Protein with A Death Domain, CRADD, RAIDD |
| Accession # |
P78560 |
| Formulation |
Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4 |
| Shipping |
The product is shipped at ambient temperature. |
| Reconstitution |
Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg/ml.
Dissolve the lyophilized protein in 1X PBS.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
| Storage |
Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
| Purity |
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
| Endotoxin |
Less than 0.1 ng/µg (1 IEU/µg). |
| Amino Acid Sequence |
GSHMEARDKQVLRSLRLELGAEVLVEGLVLQYLYQEGILTENHIQEINAQTTGLRKTMLLLDILP SRGPKAFDTFLDSLQEFPWVREKLKKAREEAMTDLPAGDRLTGIPSHILNSSPSDRQINQLAQRL GPEWEPMVLSLGLSQTDIYRCKANHPHNVQSQVVEAFIRWRQRFGKQATFQSLHNGLRAVEVDPS LLLHMLE
|
| Background |
Death Domain-Containing Protein CRADD (CRADD) is widely expressed in most tissues, with particularly high expression in the adult heart, testis, liver, skeletal muscle, fetal liver, and kidney. CRADD contains one CARD domain that mediates the interaction with caspase-2, and one death domain involved in the binding of RIP protein. CRADD functions as an apoptotic adaptor molecule specific for caspase-2 and FASL/TNF receptor-interacting protein RIP. CRADD induces cell apoptosis/cell death in numerous tissues. Defects in CRADD will result in mental retardation. |