| Catalog# |
CH35 |
| Source |
E.coli |
| Description |
Recombinant Human CSN2 is produced by our E. coli expression system. The target protein is expressed with sequence (Glu26-Val226) of Human CSN2 fused with a 6His tag at the N-terminus. |
| Names |
CSN2，CASB |
| Accession # |
P05814 |
| Formulation |
Lyophilized from a 0.2 μm filtered solution of PBS,pH 7.4 |
| Shipping |
The product is shipped at ambient temperature. |
| Reconstitution |
Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg/ml.
Dissolve the lyophilized protein in 1X PBS.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
| Storage |
Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
| Purity |
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
| Endotoxin |
Less than 0.1 ng/µg (1 IEU/µg). |
| Amino Acid Sequence |
MNHKVHHHHHHMEESITEYKQKVEKVKHEDQQQGEDEHQDKIYPSFQPQPLIYPFVEPIPYGFLP QNILPLAQPAVVLPVPQPEIMEVPKAKDTVYTKGRVMPVLKSPTIPFFDPQIPKLTDLENLHLPL PLLQPLMQQVPQPIPQTLALPPQPLWSVPQPKVLPIPQQVVPYPQRAVPVQALLLNQELLLNPTH QIYPVTQPLAPVHNPISV
|
| Background |
Beta-casein is a protein that in humans is encoded by the CSN2 gene.Beta-casein is a 226 amino acids protein that belongs to the beta-casein family.It is secreted in milk. Beta-casein palys important role in determination of the surface properties of the casein micelles. |
