| Catalog# |
CA28 |
| Source |
HEK293 |
| Description |
Recombinant Human Pro-Cathepsin H/CTSH is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Ala23-Val335) of Human CTSH fused with a 6His tag at the C-terminus. |
| Names |
Pro-Cathepsin H, CTSH, CPSB |
| Accession # |
P09668 |
| Formulation |
Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.4. |
| Shipping |
The product is shipped at ambient temperature. |
| Reconstitution |
Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg/ml.
Dissolve the lyophilized protein in ddH2O.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
| Storage |
Store at < -20°C, stable for 6 months after receipt.
Please minimize freeze-thaw cycles. |
| Purity |
Greater than 95% as determined by reducing SDS-PAGE. |
| Endotoxin |
Less than 0.1 ng/μg (1 IEU/μg). |
| Amino Acid Sequence |
AELSVNSLEKFHFKSWMSKHRKTYSTEEYHHRLQTFASNWRKINAHNNGNHTFKMALNQFSDMSF AEIKHKYLWSEPQNCSATKSNYLRGTGPYPPSVDWRKKGNFVSPVKNQGACGSCWTFSTTGALES AIAIATGKMLSLAEQQLVDCAQDFNNHGCQGGLPSQAFEYILYNKGIMGEDTYPYQGKDGYCKFQ PGKAIGFVKDVANITIYDEEAMVEAVALYNPVSFAFEVTQDFMMYRTGIYSSTSCHKTPDKVNHA VLAVGYGEKNGIPYWIVKNSWGPQWGMNGYFLIERGKNMCGLAACASYPIPLVVDHHHHHH
|
| Background |
Pro-Cathepsin H (CTSH) is a lysosomal cysteine proteinase that belongs to the peptidase C1 family. CTSH is composed of a dimer of disulfide-linked heavy and light chains, both produced from a single protein precursor. CTSH is important for the overall degradation of proteins in lysosomes. CTSH hydrolyzes lysosomal proteins, acting as an aminopeptidase (notably, cleaving Arg- -Xaa bonds) as well as an endopeptidase. Increased expression of CTSH has been correlated with malignant progression of prostate tumors. |
